{ "uniprot_canonical_ac": "A0A1W2PPM1-1", "uniprot_ac": "A0A1W2PPM1", "uniprot_id": "CPHXL_HUMAN", "mass": { "chemical_mass": 45714.0, "monoisotopic_mass": 45714.0 }, "refseq": {}, "gene_names": [ { "name": "CPHXL", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1W2PPM1", "id": "A0A1W2PPM1" }, { "name": "CPHX1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A1W2PPM1", "id": "A0A1W2PPM1" } ], "protein_names": [ { "name": "Cytoplasmic polyadenylated homeobox-like protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A1W2PPM1" }, { "name": "Cytoplasmic polyadenylated homeobox 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A1W2PPM1" } ], "function": [ { "annotation": "Transcription factor that acts as activator.", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PPM1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPM1#function" }, { "database": "PubMed", "id": "27412763", "url": "https://glygen.org/publication/PubMed/27412763" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PPM1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPM1" } ], "common_name": "Human" } ], "gene": [ { "name": "CPHXL", "url": "https://www.uniprot.org/uniprot/A0A1W2PPM1", "locus": { "chromosome": "16", "start_pos": 75714131, "end_pos": 75726490, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000283755", "url": "https://www.ensembl.org/id/ENSG00000283755" } ] } } ], "crossref": [ { "id": "ENSG00000283755", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000283755", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00086", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00086", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CPHXL", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CPHXL", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "51815", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=51815", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR001356", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001356", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "618700", "url": "http://www.omim.org/entry/618700", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_A0A1W2PPM1", "url": "https://www.nextprot.org/entry/NX_A0A1W2PPM1", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "IFGENCY", "url": "https://omabrowser.org/oma/group/IFGENCY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4691406at2759", "url": "http://www.orthodb.org/?query=4691406at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24341", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24341", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24341:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24341:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00046", "url": "http://pfam.xfam.org/family/PF00046", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A1W2PPM1", "url": "http://purl.obolibrary.org/obo/PR_A0A1W2PPM1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "A0A1W2PPM1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPM1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPM1-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPM1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNLDGTSGGFPAEEDHHNEERQTKNKRKTKHRHKFSEELLQELKEIFGENCYPDYTTRKTLAIKFDCPVNVIDNWFQNKRARLPPAERRRIFVLQKKHDFPVQAHSFLSCQETQAAAHNYATKQSLSGAQRALMRRAGCSHLEKQWIPSQEMGYNCFSLENQETPSQQVGPQCSYLEKPGIPSQQVGSQCSYLEKLGIPSQQVASQSSYLVTGTEKHPGCAMGYGGDTGSGHSGSGHSTAYHFLSYNSAECLHPPPSSVPYFHGERTETKESQHASPFLLDYAQGAYGVKKDHCLCSFCLSLLGQQQQNDWQYHLQQHQQPQNYLEGMMLQEQLPMDSGPWDLGKQWSSAQSQLQSQLPQNNGKPLCSQLQHMSLQIAADSPLLPLGQDMQERASEQPRTQMQQL", "length": 405, "header": "sp|A0A1W2PPM1-1|CPHXL_HUMAN Isoform 1 of Cytoplasmic polyadenylated homeobox-like protein OS=Homo sapiens OX=9606 GN=CPHXL PE=2 SV=1 CANONICAL=A0A1W2PPM1-1" }, "isoforms": [ { "isoform_ac": "A0A1W2PPM1-1", "url": "", "sequence": { "sequence": "MNLDGTSGGFPAEEDHHNEERQTKNKRKTKHRHKFSEELLQELKEIFGENCYPDYTTRKTLAIKFDCPVNVIDNWFQNKRARLPPAERRRIFVLQKKHDFPVQAHSFLSCQETQAAAHNYATKQSLSGAQRALMRRAGCSHLEKQWIPSQEMGYNCFSLENQETPSQQVGPQCSYLEKPGIPSQQVGSQCSYLEKLGIPSQQVASQSSYLVTGTEKHPGCAMGYGGDTGSGHSGSGHSTAYHFLSYNSAECLHPPPSSVPYFHGERTETKESQHASPFLLDYAQGAYGVKKDHCLCSFCLSLLGQQQQNDWQYHLQQHQQPQNYLEGMMLQEQLPMDSGPWDLGKQWSSAQSQLQSQLPQNNGKPLCSQLQHMSLQIAADSPLLPLGQDMQERASEQPRTQMQQL", "length": 405, "header": "sp|A0A1W2PPM1-1|CPHXL_HUMAN Isoform 1 of Cytoplasmic polyadenylated homeobox-like protein OS=Homo sapiens OX=9606 GN=CPHXL PE=2 SV=1 CANONICAL=A0A1W2PPM1-1" }, "locus": { "chromosome": "16", "start_pos": 75726442, "end_pos": 75714227, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640559.2", "url": "https://www.ensembl.org/id/ENST00000640559.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000491599.1", "url": "https://www.ensembl.org/id/ENSP00000491599.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization and target genes of nine human PRD-like homeobox domain genes expressed exclusively in early embryos.", "journal": "Scientific reports", "date": "2016-07-14", "authors": "Madissoon Elo, Jouhilahti Eeva-Mari, Vesterlund Liselotte, T\u00f6h\u00f6nen Virpi, Krjut\u0161kov Kaarel, Petropoulos Sophie, Einarsdottir Elisabet, Linnarsson Sten, Lanner Fredrik, M\u00e5nsson Robert, Hovatta Outi, B\u00fcrglin Thomas R, Katayama Shintaro, Kere Juha", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PPM1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPM1" } ], "reference": [ { "type": "PubMed", "id": "27412763", "url": "https://glygen.org/publication/PubMed/27412763" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PPM1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPM1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PPM1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPM1" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PPM1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPM1" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PPM1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPM1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }