{ "uniprot_canonical_ac": "A0A1B0GVK7-1", "uniprot_ac": "A0A1B0GVK7", "uniprot_id": "F240A_HUMAN", "mass": { "chemical_mass": 10377.0, "monoisotopic_mass": 10377.0 }, "refseq": { "ac": "NP_001182371", "name": "protein FAM240A", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001182371" }, "gene_names": [ { "name": "FAM240A", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1B0GVK7", "id": "A0A1B0GVK7" }, { "name": "FAM240A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001182371", "id": "NP_001182371" } ], "protein_names": [ { "name": "Protein FAM240A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A1B0GVK7" }, { "name": "protein FAM240A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001182371", "id": "NP_001182371" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GVK7", "url": "https://www.uniprot.org/uniprot/A0A1B0GVK7" } ], "common_name": "Human" } ], "gene": [ { "name": "FAM240A", "url": "https://www.uniprot.org/uniprot/A0A1B0GVK7", "locus": { "chromosome": "3", "start_pos": 46626543, "end_pos": 46612525, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000283473", "url": "https://www.ensembl.org/id/ENSG00000283473" } ] } } ], "crossref": [ { "id": "ENSG00000283473", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000283473", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FAM240A", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FAM240A", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "100132146", "url": "https://www.ncbi.nlm.nih.gov/gene/100132146", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "52390", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=52390", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR040261", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040261", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:100132146", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100132146", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_A0A1B0GVK7", "url": "https://www.nextprot.org/entry/NX_A0A1B0GVK7", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "IGKQTCY", "url": "https://omabrowser.org/oma/group/IGKQTCY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4221723at2759", "url": "http://www.orthodb.org/?query=4221723at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR40387", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR40387", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR40387:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR40387:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "A0A1B0GVK7", "url": "https://pharos.nih.gov/targets/A0A1B0GVK7", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_A0A1B0GVK7", "url": "http://purl.obolibrary.org/obo/PR_A0A1B0GVK7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001182371", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001182371", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1B0GVK7", "url": "https://www.uniprot.org/uniprot/A0A1B0GVK7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GVK7-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GVK7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRLFSGMNNQYTRREVFCRNTCHDLKHFWEREIGKQTYYRESEERRLGRSALRKLREEWKQRLETKLRLRNNPEDTEKRTNVG", "length": 83, "header": "sp|A0A1B0GVK7-1|F240A_HUMAN Isoform 1 of Protein FAM240A OS=Homo sapiens OX=9606 GN=FAM240A PE=3 SV=3 CANONICAL=A0A1B0GVK7-1" }, "isoforms": [ { "isoform_ac": "A0A1B0GVK7-1", "url": "", "sequence": { "sequence": "MRLFSGMNNQYTRREVFCRNTCHDLKHFWEREIGKQTYYRESEERRLGRSALRKLREEWKQRLETKLRLRNNPEDTEKRTNVG", "length": 83, "header": "sp|A0A1B0GVK7-1|F240A_HUMAN Isoform 1 of Protein FAM240A OS=Homo sapiens OX=9606 GN=FAM240A PE=3 SV=3 CANONICAL=A0A1B0GVK7-1" }, "locus": { "chromosome": "3", "start_pos": 46625215, "end_pos": 46612684, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640551.3", "url": "https://www.ensembl.org/id/ENST00000640551.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000491838.2", "url": "https://www.ensembl.org/id/ENSP00000491838.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "hsa:100132146", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100132146", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "J3QNP9-1", "protein_name": "Family with sequence similarity 240 member A", "gene_name": "Fam240a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNNQYVRREVFCRNSCHELKRFWEREIGKQACYRESEEHRLGRSALRKLREEWKQRLETKLRLRNNPDEAEKRANVSSELPASATDRGAEVTPLEAS", "length": 97 }, "evidence": [ { "id": "45933756", "url": "http://www.informatics.jax.org/homology/45933756", "database": "MGI" }, { "id": "A0A1B0GVK7", "url": "https://omabrowser.org/oma/group/A0A1B0GVK7/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }