{ "uniprot_canonical_ac": "A0A286ZRT7-1", "uniprot_ac": "A0A286ZRT7", "uniprot_id": "A0A286ZRT7_PIG", "mass": { "chemical_mass": 39063.0, "monoisotopic_mass": 39063.0 }, "refseq": { "ac": "XP_005673791", "name": "cysteinyl leukotriene receptor 1 isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005673791" }, "gene_names": [ { "name": "CYSLTR1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7", "id": "A0A286ZRT7" }, { "name": "CYCLT1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005673791", "id": "XP_005673791" }, { "name": "CYSLTR1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005673791", "id": "XP_005673791" } ], "protein_names": [ { "name": "Cysteinyl leukotriene receptor 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A286ZRT7" }, { "name": "cysteinyl leukotriene receptor 1 isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005673791", "id": "XP_005673791" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A0A286ZRT7", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7" } ], "common_name": "Pig" } ], "gene": [ { "name": "CYSLTR1", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7", "locus": { "chromosome": "LUXU01008114.1", "start_pos": 61638, "end_pos": 33310, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00055002399", "url": "https://www.ensembl.org/id/ENSSSCG00055002399" } ] } } ], "crossref": [ { "id": "ENSSSCG00000039203", "url": "https://bgee.org/?page=gene&gene_id=ENSSSCG00000039203", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15158", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15158", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "397242", "url": "https://www.ncbi.nlm.nih.gov/gene/397242", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004071", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004071", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013310", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013310", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "CVMTLPL", "url": "https://omabrowser.org/oma/group/CVMTLPL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2875155at2759", "url": "http://www.orthodb.org/?query=2875155at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24231", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24231", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24231:SF45", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24231:SF45", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00001", "url": "http://pfam.xfam.org/family/PF00001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-391906", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-391906", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-416476", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_005673791", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005673791", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A286ZRT7", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A286ZRT7-1", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDGVRNLTVSSASSNTCNDTIDDFRNQVYSTLYSMITVVGFFGNGFVLYVLIKTYHEKSAYQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLITHKKAKIVCIAIWIFVILTSSPFLMSTSYKDEKNNTKCFEPPQDNQAKYHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKNSMKKNISSRKKAIGMIIVVTAAFLISFMPYHIQRTIHLHFLHNDTKHCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSMTYVPKKKTSLPEKGEEIYKE", "length": 340, "header": "tr|A0A286ZRT7-1|A0A286ZRT7_PIG Isoform 1 of Cysteinyl leukotriene receptor 1 OS=Sus scrofa OX=9823 GN=CYSLTR1 PE=4 SV=1 CANONICAL=A0A286ZRT7-1" }, "isoforms": [ { "isoform_ac": "A0A286ZRT7-1", "url": "", "sequence": { "sequence": "MDGVRNLTVSSASSNTCNDTIDDFRNQVYSTLYSMITVVGFFGNGFVLYVLIKTYHEKSAYQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLITHKKAKIVCIAIWIFVILTSSPFLMSTSYKDEKNNTKCFEPPQDNQAKYHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKNSMKKNISSRKKAIGMIIVVTAAFLISFMPYHIQRTIHLHFLHNDTKHCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSMTYVPKKKTSLPEKGEEIYKE", "length": 340, "header": "tr|A0A286ZRT7-1|A0A286ZRT7_PIG Isoform 1 of Cysteinyl leukotriene receptor 1 OS=Sus scrofa OX=9823 GN=CYSLTR1 PE=4 SV=1 CANONICAL=A0A286ZRT7-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Genes of the pig, Sus scrofa, reconstructed with EvidentialGene.", "journal": "PeerJ", "date": "2019", "authors": "Gilbert Donald G", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZRT7", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7" } ], "reference": [ { "type": "PubMed", "id": "30723633", "url": "https://glygen.org/publication/PubMed/30723633" } ] } ], "pathway": [ { "id": "R-SSC-391906", "name": "Leukotriene receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-391906", "resource": "Reactome", "description": "Leukotriene receptors" }, { "id": "R-SSC-416476", "name": "G alpha (q) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-416476", "resource": "Reactome", "description": "G alpha (q) signalling events" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZRT7", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "chemotaxis", "id": "GO:0006935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006935", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZRT7", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7" } ], "pmid": "" }, { "name": "cell surface receptor signaling pathway", "id": "GO:0007166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZRT7", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7" } ], "pmid": "" }, { "name": "neuropeptide signaling pathway", "id": "GO:0007218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007218", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZRT7", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7" } ], "pmid": "" }, { "name": "inflammatory response to antigenic stimulus", "id": "GO:0002437", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002437", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZRT7", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7" } ], "pmid": "" }, { "name": "calcium ion transport", "id": "GO:0006816", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006816", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZRT7", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7" } ], "pmid": "" }, { "name": "establishment of localization in cell", "id": "GO:0051649", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051649", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZRT7", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled peptide receptor activity", "id": "GO:0008528", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008528", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZRT7", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7" } ], "pmid": "" }, { "name": "cysteinyl leukotriene receptor activity", "id": "GO:0001631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001631", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZRT7", "url": "https://www.uniprot.org/uniprot/A0A286ZRT7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 172, "end_pos": 174, "annotation": "n_glycosylation_sequon" }, { "start_pos": 18, "end_pos": 20, "annotation": "n_glycosylation_sequon" }, { "start_pos": 227, "end_pos": 229, "annotation": "n_glycosylation_sequon" }, { "start_pos": 265, "end_pos": 267, "annotation": "n_glycosylation_sequon" }, { "start_pos": 6, "end_pos": 8, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 172, "end_pos": 174 }, { "start_pos": 18, "end_pos": 20 }, { "start_pos": 227, "end_pos": 229 }, { "start_pos": 265, "end_pos": 267 }, { "start_pos": 6, "end_pos": 8 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }