{ "uniprot_canonical_ac": "A0A286ZPV1-1", "uniprot_ac": "A0A286ZPV1", "uniprot_id": "A0A286ZPV1_PIG", "mass": { "chemical_mass": 20811.0, "monoisotopic_mass": 20811.0 }, "refseq": { "ac": "XP_003359928", "name": "prion-like protein doppel", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003359928" }, "gene_names": [ { "name": "PRND", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A286ZPV1", "id": "A0A286ZPV1" }, { "name": "PRND", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003359928", "id": "XP_003359928" } ], "protein_names": [ { "name": "Prion like protein doppel", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A286ZPV1" }, { "name": "prion-like protein doppel", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003359928", "id": "XP_003359928" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A0A286ZPV1", "url": "https://www.uniprot.org/uniprot/A0A286ZPV1" } ], "common_name": "Pig" } ], "gene": [ { "name": "PRND", "url": "https://www.uniprot.org/uniprot/A0A286ZPV1", "locus": { "chromosome": "LUXQ01123641.1", "start_pos": 192295, "end_pos": 198052, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00040057783", "url": "https://www.ensembl.org/id/ENSSSCG00040057783" } ] } } ], "crossref": [ { "id": "ENSSSCG00000032923", "url": "https://bgee.org/?page=gene&gene_id=ENSSSCG00000032923", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "100512378", "url": "https://www.ncbi.nlm.nih.gov/gene/100512378", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR021566", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021566", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022416", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022416", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036924", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036924", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ssc:100512378", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:100512378", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HYDGCSE", "url": "https://omabrowser.org/oma/group/HYDGCSE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5324348at2759", "url": "http://www.orthodb.org/?query=5324348at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15506", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15506", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15506:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15506:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00377", "url": "http://pfam.xfam.org/family/PF00377", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF11466", "url": "http://pfam.xfam.org/family/PF11466", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-163125", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-163125", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_003359928", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003359928", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A286ZPV1", "url": "https://www.uniprot.org/uniprot/A0A286ZPV1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A286ZPV1-1", "url": "https://www.uniprot.org/uniprot/A0A286ZPV1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRKHLGGRRWAIVCILLFSQLSEVKARGIKHRIKWNRKALPSTSQVTEAHTAEMRPGAFIKQGRKLDIDFGAEGNRYYEANYWRFPDGIHYNGCSEVNVTKEKFVTSCINTTQAANQEELSHEKPDNKLYQRVLWRLIRELCSIKHCDFWLERGAGLRVTMDQPMMLCLLVFIWLIVK", "length": 178, "header": "tr|A0A286ZPV1-1|A0A286ZPV1_PIG Isoform 1 of Prion like protein doppel OS=Sus scrofa OX=9823 GN=PRND PE=3 SV=1 CANONICAL=A0A286ZPV1-1" }, "isoforms": [ { "isoform_ac": "A0A286ZPV1-1", "url": "", "sequence": { "sequence": "MRKHLGGRRWAIVCILLFSQLSEVKARGIKHRIKWNRKALPSTSQVTEAHTAEMRPGAFIKQGRKLDIDFGAEGNRYYEANYWRFPDGIHYNGCSEVNVTKEKFVTSCINTTQAANQEELSHEKPDNKLYQRVLWRLIRELCSIKHCDFWLERGAGLRVTMDQPMMLCLLVFIWLIVK", "length": 178, "header": "tr|A0A286ZPV1-1|A0A286ZPV1_PIG Isoform 1 of Prion like protein doppel OS=Sus scrofa OX=9823 GN=PRND PE=3 SV=1 CANONICAL=A0A286ZPV1-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "ssc:100512378", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:100512378", "resource": "KEGG Pathway" }, { "id": "R-SSC-163125", "name": "Post-translational modification: synthesis of GPI-anchored proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-163125", "resource": "Reactome", "description": "Post-translational modification: synthesis of GPI-anchored proteins" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "intracellular copper ion homeostasis", "id": "GO:0006878", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006878", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZPV1", "url": "https://www.uniprot.org/uniprot/A0A286ZPV1" } ], "pmid": "" }, { "name": "protein homooligomerization", "id": "GO:0051260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051260", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZPV1", "url": "https://www.uniprot.org/uniprot/A0A286ZPV1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZPV1", "url": "https://www.uniprot.org/uniprot/A0A286ZPV1" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "copper ion binding", "id": "GO:0005507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005507", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZPV1", "url": "https://www.uniprot.org/uniprot/A0A286ZPV1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 110, "end_pos": 112, "annotation": "n_glycosylation_sequon" }, { "start_pos": 98, "end_pos": 100, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 110, "end_pos": 112 }, { "start_pos": 98, "end_pos": 100 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }