{ "uniprot_canonical_ac": "A0A286ZP11-1", "uniprot_ac": "A0A286ZP11", "uniprot_id": "A0A286ZP11_PIG", "mass": { "chemical_mass": 15125.0, "monoisotopic_mass": 15125.0 }, "refseq": {}, "gene_names": [ { "name": "LOC110258323", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A286ZP11", "id": "A0A286ZP11" } ], "protein_names": [ { "name": "Protein S100", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A286ZP11" }, { "name": "S100 calcium-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A286ZP11" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP11", "url": "https://www.uniprot.org/uniprot/A0A286ZP11" } ], "common_name": "Pig" } ], "gene": [ { "name": "LOC110258323", "url": "https://www.uniprot.org/uniprot/A0A286ZP11", "locus": { "chromosome": "AEMK02000326.1", "start_pos": 8132, "end_pos": 12837, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00000035756", "url": "https://www.ensembl.org/id/ENSSSCG00000035756" } ] } } ], "crossref": [ { "id": "ENSSSCG00000035756", "url": "https://bgee.org/?page=gene&gene_id=ENSSSCG00000035756", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05027", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05027", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001751", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001751", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013787", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013787", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028481", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028481", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "4606407at2759", "url": "http://www.orthodb.org/?query=4606407at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11639", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11639", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11639:SF134", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11639:SF134", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00036", "url": "http://pfam.xfam.org/family/PF00036", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01023", "url": "http://pfam.xfam.org/family/PF01023", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A286ZP11", "url": "https://www.uniprot.org/uniprot/A0A286ZP11", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A286ZP11-1", "url": "https://www.uniprot.org/uniprot/A0A286ZP11-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINSELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMVTTACHEFLLNTSELEKTDTQFLQRRRAHRAGQWRQGFGRTVGAELSGCVVAN", "length": 133, "header": "tr|A0A286ZP11-1|A0A286ZP11_PIG Isoform 1 of Protein S100 OS=Sus scrofa OX=9823 GN=LOC110258323 PE=3 SV=1 CANONICAL=A0A286ZP11-1" }, "isoforms": [ { "isoform_ac": "A0A286ZP11-1", "url": "", "sequence": { "sequence": "MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINSELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMVTTACHEFLLNTSELEKTDTQFLQRRRAHRAGQWRQGFGRTVGAELSGCVVAN", "length": 133, "header": "tr|A0A286ZP11-1|A0A286ZP11_PIG Isoform 1 of Protein S100 OS=Sus scrofa OX=9823 GN=LOC110258323 PE=3 SV=1 CANONICAL=A0A286ZP11-1" }, "locus": { "chromosome": "AEMK02000326.1", "start_pos": 11947, "end_pos": 8725, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSSSCT00000056761.3", "url": "https://www.ensembl.org/id/ENSSSCT00000056761.3" }, { "database": "Ensembl Peptide", "id": "ENSSSCP00000033357.1", "url": "https://www.ensembl.org/id/ENSSSCP00000033357.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "RAGE receptor binding", "id": "GO:0050786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050786", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP11", "url": "https://www.uniprot.org/uniprot/A0A286ZP11" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP11", "url": "https://www.uniprot.org/uniprot/A0A286ZP11" } ], "pmid": "" }, { "name": "calcium-dependent protein binding", "id": "GO:0048306", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048306", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP11", "url": "https://www.uniprot.org/uniprot/A0A286ZP11" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP11", "url": "https://www.uniprot.org/uniprot/A0A286ZP11" } ], "pmid": "" }, { "name": "S100 protein binding", "id": "GO:0044548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044548", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP11", "url": "https://www.uniprot.org/uniprot/A0A286ZP11" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP11", "url": "https://www.uniprot.org/uniprot/A0A286ZP11" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP11", "url": "https://www.uniprot.org/uniprot/A0A286ZP11" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP11", "url": "https://www.uniprot.org/uniprot/A0A286ZP11" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP11", "url": "https://www.uniprot.org/uniprot/A0A286ZP11" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP11", "url": "https://www.uniprot.org/uniprot/A0A286ZP11" } ], "pmid": "" }, { "name": "positive regulation of canonical NF-kappaB signal transduction", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZP11", "url": "https://www.uniprot.org/uniprot/A0A286ZP11" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 91, "end_pos": 93, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 91, "end_pos": 93 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }