{ "uniprot_canonical_ac": "A0A286ZLU2-1", "uniprot_ac": "A0A286ZLU2", "uniprot_id": "A0A286ZLU2_PIG", "mass": { "chemical_mass": 32318.0, "monoisotopic_mass": 32318.0 }, "refseq": {}, "gene_names": [ { "name": "HAAO", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2", "id": "A0A286ZLU2" } ], "protein_names": [ { "name": "3-hydroxyanthranilate 3,4-dioxygenase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A286ZLU2" }, { "name": "1.13.11.6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A286ZLU2" }, { "name": "3-HAO", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A286ZLU2" }, { "name": "3-hydroxyanthranilate oxygenase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A286ZLU2" }, { "name": "3-hydroxyanthranilic acid dioxygenase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A286ZLU2" }, { "name": "HAD", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A286ZLU2" } ], "function": [ { "annotation": "Catalyzes the oxidative ring opening of 3-hydroxyanthranilate to 2-amino-3-carboxymuconate semialdehyde, which spontaneously cyclizes to quinolinate.", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2#function" }, { "database": "UniProtKB", "id": "MF_03019", "url": "https://www.uniprot.org/uniprot/MF_03019#function" }, { "database": "UniProtKB", "id": "ARBA00002752", "url": "https://www.uniprot.org/uniprot/ARBA00002752#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2" } ], "common_name": "Pig" } ], "gene": [ { "name": "HAAO", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2", "locus": { "chromosome": "3", "start_pos": 97595021, "end_pos": 97580851, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00000038660", "url": "https://www.ensembl.org/id/ENSSSCG00000038660" } ] } } ], "crossref": [ { "id": "ENSSSCG00000038660", "url": "https://bgee.org/?page=gene&gene_id=ENSSSCG00000038660", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd06123", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06123", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR010329", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010329", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011051", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011051", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014710", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014710", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016700", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016700", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "2907058at2759", "url": "http://www.orthodb.org/?query=2907058at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15497", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15497", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15497:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15497:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF06052", "url": "http://pfam.xfam.org/family/PF06052", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-71240", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-71240", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "17953", "url": "https://www.rhea-db.org/rhea/17953", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A286ZLU2-1", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MERPVRVKAWVEENRASFLPPVCNKLLHQKQLKIMFVGGPNTRKDYHIEEGEEVFYQLEGDMLLRVLERGEHRDVVIRQGEIFLLPAGVPHSPQRFANTVGLVIERRRLKTELDGLRYYIGDTTDVLFEKWFYCEDLGTQLAPIIQEFFSSEQHRTGKPNPDQLLKEPPFPLSTRSVMEPMSLEAWLAGHRKELQAGTPLSLFGDTYETQVIVHGQGSSKGPRQDVDVWLWQLEGSSVVTMEGEHLSLTPGDSLLVPAGTAYGWERGQGSAALSVTQDPTRKKPLG", "length": 286, "header": "tr|A0A286ZLU2-1|A0A286ZLU2_PIG Isoform 1 of 3-hydroxyanthranilate 3,4-dioxygenase OS=Sus scrofa OX=9823 GN=HAAO PE=3 SV=1 CANONICAL=A0A286ZLU2-1" }, "isoforms": [ { "isoform_ac": "A0A286ZLU2-1", "url": "", "sequence": { "sequence": "MERPVRVKAWVEENRASFLPPVCNKLLHQKQLKIMFVGGPNTRKDYHIEEGEEVFYQLEGDMLLRVLERGEHRDVVIRQGEIFLLPAGVPHSPQRFANTVGLVIERRRLKTELDGLRYYIGDTTDVLFEKWFYCEDLGTQLAPIIQEFFSSEQHRTGKPNPDQLLKEPPFPLSTRSVMEPMSLEAWLAGHRKELQAGTPLSLFGDTYETQVIVHGQGSSKGPRQDVDVWLWQLEGSSVVTMEGEHLSLTPGDSLLVPAGTAYGWERGQGSAALSVTQDPTRKKPLG", "length": 286, "header": "tr|A0A286ZLU2-1|A0A286ZLU2_PIG Isoform 1 of 3-hydroxyanthranilate 3,4-dioxygenase OS=Sus scrofa OX=9823 GN=HAAO PE=3 SV=1 CANONICAL=A0A286ZLU2-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "R-SSC-71240", "name": "Tryptophan catabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-71240", "resource": "Reactome", "description": "Tryptophan catabolism" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "tryptophan catabolic process", "id": "GO:0006569", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006569", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2" } ], "pmid": "" }, { "name": "response to zinc ion", "id": "GO:0010043", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010043", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2" } ], "pmid": "" }, { "name": "neuron cellular homeostasis", "id": "GO:0070050", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070050", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2" } ], "pmid": "" }, { "name": "response to cadmium ion", "id": "GO:0046686", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046686", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2" } ], "pmid": "" }, { "name": "quinolinate biosynthetic process", "id": "GO:0019805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019805", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2" } ], "pmid": "" }, { "name": "anthranilate metabolic process", "id": "GO:0043420", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043420", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2" } ], "pmid": "" }, { "name": "'de novo' NAD biosynthetic process from tryptophan", "id": "GO:0034354", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034354", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2" } ], "pmid": "" }, { "name": "quinolinate metabolic process", "id": "GO:0046874", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046874", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "3-hydroxyanthranilate 3,4-dioxygenase activity", "id": "GO:0000334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000334", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2" } ], "pmid": "" }, { "name": "ferrous iron binding", "id": "GO:0008198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008198", "evidence": [ { "database": "UniProtKB", "id": "A0A286ZLU2", "url": "https://www.uniprot.org/uniprot/A0A286ZLU2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "17953", "name": "", "equation": "3-hydroxyanthranilate + O2 = (2Z,4Z)-2-amino-3-carboxymuconate 6-semialdehyde", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P46953-1", "P46952-1", "Q78JT3-1", "P47096-1", "Q54S02-1" ], "evidence": [ { "id": "17953", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17953" } ] }, { "id": "R-SSC-71218", "name": "3-hydroxyanthranilate + O2 => 2-amino-3-carboxymuconate semialdehyde", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-36027" ], "enzyme_list": [], "evidence": [ { "id": "R-SSC-71218", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-71218" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-36027", "participant_name": "ACS [cytosol]", "crossref": [ { "id": "C04409", "database": "COMPOUND", "url": "" }, { "id": "77803", "database": "ChEBI", "url": "" }, { "id": "000031259156", "database": "ZINC", "url": "" }, { "id": "C04409", "database": "COMPOUND", "url": "" }, { "id": "77803", "database": "ChEBI", "url": "" }, { "id": "000031259156", "database": "ZINC", "url": "" }, { "id": "C04409", "database": "COMPOUND", "url": "" }, { "id": "77803", "database": "ChEBI", "url": "" }, { "id": "000031259156", "database": "ZINC", "url": "" }, { "id": "C04409", "database": "COMPOUND", "url": "" }, { "id": "77803", "database": "ChEBI", "url": "" }, { "id": "000031259156", "database": "ZINC", "url": "" }, { "id": "000031259156", "database": "ZINC", "url": "" }, { "id": "C04409", "database": "COMPOUND", "url": "" }, { "id": "77803", "database": "ChEBI", "url": "" }, { "id": "C04409", "database": "COMPOUND", "url": "" }, { "id": "77803", "database": "ChEBI", "url": "" }, { "id": "000031259156", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P46952", "gene_name": "HAAO", "activity": [ { "ec_number": "1.13.11.6", "activity": "3-hydroxyanthranilate + O2 = (2Z,4Z)-2-amino-3-carboxymuconate 6-semialdehyde.", "evidence": [ { "id": "P46952", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46952" } ] }, { "ec_number": "1.13.11.6", "activity": "", "evidence": [ { "id": "P46952", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46952" } ] } ] }, { "uniprot_ac": "P46953", "gene_name": "Haao", "activity": [ { "ec_number": "1.13.11.6", "activity": "3-hydroxyanthranilate + O2 = (2Z,4Z)-2-amino-3-carboxymuconate 6-semialdehyde.", "evidence": [ { "id": "P46953", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46953" } ] }, { "ec_number": "1.13.11.6", "activity": "", "evidence": [ { "id": "P46953", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46953" } ] } ] }, { "uniprot_ac": "P47096", "gene_name": "BNA1", "activity": [ { "ec_number": "1.13.11.6", "activity": "3-hydroxyanthranilate + O2 = (2Z,4Z)-2-amino-3-carboxymuconate 6-semialdehyde.", "evidence": [ { "id": "P47096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47096" } ] }, { "ec_number": "1.13.11.6", "activity": "", "evidence": [ { "id": "P47096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47096" } ] } ] }, { "uniprot_ac": "Q54S02", "gene_name": "haao", "activity": [ { "ec_number": "1.13.11.6", "activity": "3-hydroxyanthranilate + O2 = (2Z,4Z)-2-amino-3-carboxymuconate 6-semialdehyde.", "evidence": [ { "id": "Q54S02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54S02" } ] }, { "ec_number": "1.13.11.6", "activity": "", "evidence": [ { "id": "Q54S02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54S02" } ] } ] }, { "uniprot_ac": "Q78JT3", "gene_name": "Haao", "activity": [ { "ec_number": "1.13.11.6", "activity": "3-hydroxyanthranilate + O2 = (2Z,4Z)-2-amino-3-carboxymuconate 6-semialdehyde.", "evidence": [ { "id": "Q78JT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q78JT3" } ] }, { "ec_number": "1.13.11.6", "activity": "", "evidence": [ { "id": "Q78JT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q78JT3" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }