{ "uniprot_canonical_ac": "A0A8I5ZPC4-1", "uniprot_ac": "A0A8I5ZPC4", "uniprot_id": "A0A8I5ZPC4_RAT", "mass": { "chemical_mass": 39256.0, "monoisotopic_mass": 39256.0 }, "refseq": {}, "gene_names": [ { "name": "Slc35d1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4", "id": "A0A8I5ZPC4" } ], "protein_names": [ { "name": "Solute carrier family 35 member D1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A8I5ZPC4" } ], "function": [], "disease": [ { "disease_id": "DOID:0050775", "recommended_name": { "id": "DOID:0050775", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050775", "name": "schneckenbecken dysplasia", "description": "An osteochondrodysplasia that is characterized by hypoplastic iliac bones, hypoplastic vertebral bodies, short ribs and broad long bones, prenatally lethal, has_material_basis_in homozygous or compound heterozygous mutation in the SLC35D1 gene on chromosome 1p31." }, "synonyms": [ { "id": "MONDO:0010013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010013", "name": "schneckenbecken dysplasia", "description": "Schneckenbecken dysplasia (or chondrodysplasia with snail-like pelvis) is a prenatally lethal spondylodysplastic dysplasia." }, { "id": "MONDO:0010013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010013", "name": "SLC35D1-CDG", "description": "" }, { "id": "MONDO:0010013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010013", "name": "chondrodysplasia with snail-like pelvis", "description": "" }, { "id": "MONDO:0010013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010013", "name": "schneckenbecken dysplasia", "description": "" }, { "id": "MONDO:0010013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010013", "name": "SHNKND", "description": "" }, { "id": "MONDO:0010013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010013", "name": "chondrodysplasia lethal neonatal with snail like pelvis", "description": "" }, { "id": "MONDO:0010013", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010013", "name": "chondrodysplasia, lethal neonatal, with snail-like pelvis", "description": "" }, { "id": "MIM:269250", "resource": "MIM", "url": "https://www.omim.org/entry/269250", "name": "Schneckenbecken dysplasia", "description": "Schneckenbecken dysplasia" } ], "evidence": [ { "id": "0050775", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050775" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZPC4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4" } ], "common_name": "Rat" } ], "gene": [ { "name": "Slc35d1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4", "locus": { "chromosome": "5", "start_pos": 117934352, "end_pos": 117981311, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000022967", "url": "https://www.ensembl.org/id/ENSRNOG00000022967" } ] } } ], "crossref": [ { "id": "ENSRNOG00000022967", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000022967", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR004853", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004853", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:298280", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:298280", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "IQSTVCV", "url": "https://omabrowser.org/oma/group/IQSTVCV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "7676at2759", "url": "http://www.orthodb.org/?query=7676at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11132", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11132", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11132:SF247", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11132:SF247", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03151", "url": "http://pfam.xfam.org/family/PF03151", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-173599", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-173599", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-727802", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-727802", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "1309843", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1309843", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I5ZPC4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZPC4-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AJD0", "url": "https://www.uniprot.org/uniprot/A0A8I6AJD0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AJD0-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AJD0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZVG2", "url": "https://www.uniprot.org/uniprot/D3ZVG2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZVG2-1", "url": "https://www.uniprot.org/uniprot/D3ZVG2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAEVHRRQHAPVKGEAPAKSSTHRDEEELGMAPAETLTVFLKLLAAGFYGVSSFLIVVVNKSVLTNYRFPSSLCVGLGQMVATVAVLWVGKALRVVKFPDFDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGALLKKTFSWGIKMTVFAMIIGAFIAASSDLAFDLEGYVFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFMILPTLAIAYFTGDAQKAMEFEGWADALFLLQFTLSCVMGFILMYATVLCTQYNSALTTTIVGCIKNILITYIGMVFGGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSETSNKLDTKGKGAV", "length": 355, "header": "tr|A0A8I5ZPC4-1|A0A8I5ZPC4_RAT Isoform 1 of Solute carrier family 35 member D1 OS=Rattus norvegicus OX=10116 GN=Slc35d1 PE=1 SV=1 CANONICAL=A0A8I5ZPC4-1" }, "isoforms": [ { "isoform_ac": "A0A8I5ZPC4-1", "url": "", "sequence": { "sequence": "MAEVHRRQHAPVKGEAPAKSSTHRDEEELGMAPAETLTVFLKLLAAGFYGVSSFLIVVVNKSVLTNYRFPSSLCVGLGQMVATVAVLWVGKALRVVKFPDFDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGALLKKTFSWGIKMTVFAMIIGAFIAASSDLAFDLEGYVFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFMILPTLAIAYFTGDAQKAMEFEGWADALFLLQFTLSCVMGFILMYATVLCTQYNSALTTTIVGCIKNILITYIGMVFGGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSETSNKLDTKGKGAV", "length": 355, "header": "tr|A0A8I5ZPC4-1|A0A8I5ZPC4_RAT Isoform 1 of Solute carrier family 35 member D1 OS=Rattus norvegicus OX=10116 GN=Slc35d1 PE=1 SV=1 CANONICAL=A0A8I5ZPC4-1" }, "locus": { "chromosome": "5", "start_pos": 117980813, "end_pos": 117936372, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000094233.1", "url": "https://www.ensembl.org/id/ENSRNOT00000094233.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000079911.1", "url": "https://www.ensembl.org/id/ENSRNOP00000079911.1" } ] } }, { "isoform_ac": "A0A8I6AJD0-1", "url": "", "sequence": { "sequence": "MAEVHRRQHAPVKGEAPAKSSTHRDEEELGMAPAETLTVFLKLLAAGFYGVSSFLIVVVNKSVLTNYRFPSSLCVGLGQMVATVAVLWVGKALRVVKFPDFDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGALLKKTFSWGIKMTVFAMIIGAFIAASSDLAFDLEGYVFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFMILPTLAIAYFTGDAQKNILITYIGMVFGGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSETSNKLDTKGKGAV", "length": 306, "header": "tr|A0A8I6AJD0-1|A0A8I6AJD0_RAT Computationally mapped isoform of Solute carrier family 35 member D1 OS=Rattus norvegicus OX=10116 GN=Slc35d1 PE=1 SV=1 CANONICAL=A0A8I5ZPC4-1" }, "locus": { "chromosome": "5", "start_pos": 117980813, "end_pos": 117936372, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000100643.1", "url": "https://www.ensembl.org/id/ENSRNOT00000100643.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000094333.1", "url": "https://www.ensembl.org/id/ENSRNOP00000094333.1" } ] } }, { "isoform_ac": "D3ZVG2-1", "url": "", "sequence": { "sequence": "MAPAETLTVFLKLLAAGFYGVSSFLIVVVNKSVLTNYRCASVCVLCLQMVATVAVLWVGKALRVVKFPDFDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGALLKKTFSWGIKMTVFAMIIGAFIAASSDLAFDLEGYVFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFMILPTLAIAYFTGDAQKAMEFEGWADALFLLQFTLSCVMGFILMYATVLCTQYNSALTTTIVGCIKNILITYIGMVFGGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSETSNKLDTKGKGAV", "length": 324, "header": "tr|D3ZVG2-1|D3ZVG2_RAT Computationally mapped isoform of Solute carrier family 35 member D1 OS=Rattus norvegicus OX=10116 GN=Slc35d1 PE=4 SV=2 CANONICAL=A0A8I5ZPC4-1" }, "locus": { "chromosome": "5", "start_pos": 117980723, "end_pos": 117936372, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000032126.6", "url": "https://www.ensembl.org/id/ENSRNOT00000032126.6" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000037197.5", "url": "https://www.ensembl.org/id/ENSRNOP00000037197.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:298280", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:298280", "resource": "KEGG Pathway" }, { "id": "R-RNO-173599", "name": "Formation of the active cofactor, UDP-glucuronate", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-173599", "resource": "Reactome", "description": "Formation of the active cofactor, UDP-glucuronate" }, { "id": "R-RNO-727802", "name": "Transport of nucleotide sugars", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-727802", "resource": "Reactome", "description": "Transport of nucleotide sugars" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZPC4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZPC4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZPC4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "antiporter activity", "id": "GO:0015297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015297", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZPC4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4" } ], "pmid": "" }, { "name": "pyrimidine nucleotide-sugar transmembrane transporter activity", "id": "GO:0015165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015165", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZPC4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4" } ], "pmid": "" }, { "name": "UDP-glucuronic acid transmembrane transporter activity", "id": "GO:0005461", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005461", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZPC4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4" } ], "pmid": "" }, { "name": "UDP-N-acetylglucosamine transmembrane transporter activity", "id": "GO:0005462", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005462", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZPC4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4" } ], "pmid": "" }, { "name": "GDP-fucose transmembrane transporter activity", "id": "GO:0005457", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005457", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZPC4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4" } ], "pmid": "" }, { "name": "UDP-N-acetylgalactosamine transmembrane transporter activity", "id": "GO:0005463", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005463", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZPC4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "pyrimidine nucleotide-sugar transmembrane transport", "id": "GO:0090481", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090481", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZPC4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4" } ], "pmid": "" }, { "name": "chondroitin sulfate biosynthetic process", "id": "GO:0030206", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030206", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZPC4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4" } ], "pmid": "" }, { "name": "embryonic skeletal system development", "id": "GO:0048706", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048706", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZPC4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPC4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 318, "end_pos": 320, "annotation": "n_glycosylation_sequon" }, { "start_pos": 60, "end_pos": 62, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }