{ "uniprot_canonical_ac": "A0A8I5ZM79-1", "uniprot_ac": "A0A8I5ZM79", "uniprot_id": "A0A8I5ZM79_RAT", "mass": { "chemical_mass": 37168.0, "monoisotopic_mass": 37168.0 }, "refseq": {}, "gene_names": [ { "name": "Psmd7", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM79", "id": "A0A8I5ZM79" } ], "protein_names": [ { "name": "Proteasome 26S subunit, non-ATPase 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A8I5ZM79" } ], "function": [], "disease": [ { "disease_id": "DOID:0080208", "recommended_name": { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-associated steatotic liver disease", "description": "A steatotic liver disease characterized by at least one of five cardiometabolic risk factors (adjusted for age, sex and ethnicity), alcohol consumption below 140g/week (female) or 210g/week (male), and no other discernible cause. The five cardiometabolic risk factors are:(1) Body mass index 25 kg/m2 (adult), 23 kg/m2 (adult Asian), or 85th percentile (pediatric); waist circumference > 94 cm (adult male), 80 cm (adult female), or 95th percentile (pediatric); or ethnicity adjusted equivalents.(2) Fasting serum glucose 5.6 mmol/L, 2-hr post-load glucose levels 7.8 mmol/L, glycated hemoglobin (HbA1c) 5.7% (39 mmol/L), type 2 diabetes, treatment for type 2 diabetes, previously diagnosed or treated type 2 diabetes (pediatric only), or serum glucose 11.1 mmol/L (pediatric only).(3) Blood pressure lower of 130/85 mmHg or 95th percentile (age < 13 years), or 130/85 mmHg (age 13 years); or specific hypertensive drug treatment.(4) Plasma triglycerides 1.15 mmol/L (age < 10 years) or 1.70 mmol/L (age 10 years); or lipid lowering treatment.(5) Plasma high-density lipoprotein cholesterol 1.0 mmol/L (adult male, pediatric) or 1.3 mmol/L (adult female); or lipid lowering treatment." }, "synonyms": [ { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "non-alcoholic fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "NAFLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-associated fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-related steatotic liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "MAFLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "MASLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic-associated fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "nonalcoholic fatty liver disease", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "fatty liver disease, nonalcoholic, susceptibility to, 2", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "NAFLD2", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "fatty liver disease, nonalcoholic, susceptibility to, 2", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "NAFLD1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "NAFLD1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "fatty liver disease, nonalcoholic, susceptibility to, 1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "liver disease, alcoholic, susceptibility to, 1", "description": "" }, { "id": "MIM:613282", "resource": "MIM", "url": "https://www.omim.org/entry/613282", "name": "Non-alcoholic fatty liver disease 1", "description": "Non-alcoholic fatty liver disease 1" } ], "evidence": [ { "id": "0080208", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080208" } ] }, { "disease_id": "DOID:1289", "recommended_name": { "id": "DOID:1289", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1289", "name": "neurodegenerative disease", "description": "A central nervous system disease that results in the progressive deterioration of function or structure of neurons." }, "synonyms": [ { "id": "DOID:1289", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1289", "name": "degenerative disease", "description": "" } ], "evidence": [ { "id": "1289", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1289" } ] }, { "disease_id": "DOID:1682", "recommended_name": { "id": "DOID:1682", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1682", "name": "congenital heart disease", "description": "" }, "synonyms": [ { "id": "DOID:1682", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1682", "name": "Congenital Heart Defects", "description": "" }, { "id": "DOID:1682", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1682", "name": "Congenital anomaly of heart", "description": "" }, { "id": "DOID:1682", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1682", "name": "Heart Malformation", "description": "" }, { "id": "DOID:1682", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1682", "name": "congenital heart defect", "description": "" }, { "id": "DOID:1682", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1682", "name": "heart defect", "description": "" } ], "evidence": [ { "id": "1682", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1682" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZM79", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM79" } ], "common_name": "Rat" } ], "gene": [ { "name": "Psmd7", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM79", "locus": { "chromosome": "19", "start_pos": 35494316, "end_pos": 35501588, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000014097", "url": "https://www.ensembl.org/id/ENSRNOG00000014097" } ] } } ], "crossref": [ { "id": "ENSRNOG00000014097", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000014097", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd08062", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08062", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "D4AEH3", "url": "https://www.ebi.ac.uk/intact/interactors/id:D4AEH3*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000555", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000555", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024969", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024969", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033858", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033858", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037518", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037518", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:307821", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:307821", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HAMSIKT", "url": "https://omabrowser.org/oma/group/HAMSIKT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "167030at2759", "url": "http://www.orthodb.org/?query=167030at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10540", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10540", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10540:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10540:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "6EPC", "url": "https://www.rcsb.org/structure/6EPC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EPD", "url": "https://www.rcsb.org/structure/6EPD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EPE", "url": "https://www.rcsb.org/structure/6EPE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EPF", "url": "https://www.rcsb.org/structure/6EPF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01398", "url": "http://pfam.xfam.org/family/PF01398", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13012", "url": "http://pfam.xfam.org/family/PF13012", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-1169091", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1169091", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-1234176", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1234176", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-1236978", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1236978", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-174084", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174084", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-174113", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174113", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-174154", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174154", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-174184", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174184", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-187577", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-187577", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-195253", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-195253", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2467813", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-349425", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-349425", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-350562", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-350562", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-382556", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-450408", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-450408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-4608870", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4608870", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-4641257", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4641257", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-4641258", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4641258", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5358346", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5358346", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5607761", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5607761", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5610780", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5610780", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5610785", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5610785", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5632684", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5632684", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5658442", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5658442", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5668541", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5676590", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5676590", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5687128", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5689603", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5689880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-68867", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-68949", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-68949", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-69017", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-69481", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-69481", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-69601", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-69601", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-75815", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-75815", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8852276", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8852276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8854050", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8854050", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8939236", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8941858", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8941858", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8948751", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8951664", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9755511", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9755511", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9762114", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9762114", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983168", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "1306902", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1306902", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I5ZM79", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM79", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZM79-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM79-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GIQ0", "url": "https://www.uniprot.org/uniprot/A0A8I6GIQ0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GIQ0-1", "url": "https://www.uniprot.org/uniprot/A0A8I6GIQ0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4AEH3", "url": "https://www.uniprot.org/uniprot/D4AEH3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4AEH3-1", "url": "https://www.uniprot.org/uniprot/D4AEH3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDLSLFSQDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRTYLEKVASGKLPINHHIIYQLQDVFNLLPDASLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKERKDDKEKEKSDAKKEEKKEKK", "length": 326, "header": "tr|A0A8I5ZM79-1|A0A8I5ZM79_RAT Isoform 1 of Proteasome 26S subunit, non-ATPase 7 OS=Rattus norvegicus OX=10116 GN=Psmd7 PE=1 SV=1 CANONICAL=A0A8I5ZM79-1" }, "isoforms": [ { "isoform_ac": "A0A8I5ZM79-1", "url": "", "sequence": { "sequence": "MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDLSLFSQDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRTYLEKVASGKLPINHHIIYQLQDVFNLLPDASLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKERKDDKEKEKSDAKKEEKKEKK", "length": 326, "header": "tr|A0A8I5ZM79-1|A0A8I5ZM79_RAT Isoform 1 of Proteasome 26S subunit, non-ATPase 7 OS=Rattus norvegicus OX=10116 GN=Psmd7 PE=1 SV=1 CANONICAL=A0A8I5ZM79-1" }, "locus": { "chromosome": "19", "start_pos": 35501475, "end_pos": 35494815, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000110242.1", "url": "https://www.ensembl.org/id/ENSRNOT00000110242.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000078910.1", "url": "https://www.ensembl.org/id/ENSRNOP00000078910.1" } ] } }, { "isoform_ac": "A0A8I6GIQ0-1", "url": "", "sequence": { "sequence": "MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSLSLFSQDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRTYLEKVASGKLPINHHIIYQLQDVFNLLPDASLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKERKDDKEKEKSDAKKEEKKEKK", "length": 299, "header": "tr|A0A8I6GIQ0-1|A0A8I5ZM79_RAT Computationally mapped isoform of Proteasome 26S subunit, non-ATPase 7 OS=Rattus norvegicus OX=10116 GN=Psmd7 PE=1 SV=1 CANONICAL=A0A8I5ZM79-1" }, "locus": { "chromosome": "19", "start_pos": 35501475, "end_pos": 35494815, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000108420.1", "url": "https://www.ensembl.org/id/ENSRNOT00000108420.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000090210.1", "url": "https://www.ensembl.org/id/ENSRNOP00000090210.1" } ] } }, { "isoform_ac": "D4AEH3-1", "url": "", "sequence": { "sequence": "MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMLERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRTYLEKVASGKLPINHHIIYQLQDVFNLLPDASLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKERKDDKEKEKSDAKKEEKKEKK", "length": 314, "header": "tr|D4AEH3-1|D4AEH3_RAT Computationally mapped isoform of Proteasome 26S subunit, non-ATPase 7 OS=Rattus norvegicus OX=10116 GN=Psmd7 PE=1 SV=2 CANONICAL=A0A8I5ZM79-1" }, "locus": { "chromosome": "19", "start_pos": 35501475, "end_pos": 35494815, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000019104.7", "url": "https://www.ensembl.org/id/ENSRNOT00000019104.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000019104.5", "url": "https://www.ensembl.org/id/ENSRNOP00000019104.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:307821", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:307821", "resource": "KEGG Pathway" }, { "id": "R-RNO-1169091", "name": "Activation of NF-kappaB in B cells", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1169091", "resource": "Reactome", "description": "Activation of NF-kappaB in B cells" }, { "id": "R-RNO-1234176", "name": "Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1234176", "resource": "Reactome", "description": "Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha" }, { "id": "R-RNO-1236978", "name": "Cross-presentation of soluble exogenous antigens (endosomes)", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1236978", "resource": "Reactome", "description": "Cross-presentation of soluble exogenous antigens (endosomes)" }, { "id": "R-RNO-174084", "name": "Autodegradation of Cdh1 by Cdh1:APC/C", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174084", "resource": "Reactome", "description": "Autodegradation of Cdh1 by Cdh1:APC/C" }, { "id": "R-RNO-174113", "name": "SCF-beta-TrCP mediated degradation of Emi1", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174113", "resource": "Reactome", "description": "SCF-beta-TrCP mediated degradation of Emi1" }, { "id": "R-RNO-174154", "name": "APC/C:Cdc20 mediated degradation of Securin", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174154", "resource": "Reactome", "description": "APC/C:Cdc20 mediated degradation of Securin" }, { "id": "R-RNO-174178", "name": "APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174178", "resource": "Reactome", "description": "APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1" }, { "id": "R-RNO-174184", "name": "Cdc20:Phospho-APC/C mediated degradation of Cyclin A", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-174184", "resource": "Reactome", "description": "Cdc20:Phospho-APC/C mediated degradation of Cyclin A" }, { "id": "R-RNO-187577", "name": "SCF(Skp2)-mediated degradation of p27/p21", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-187577", "resource": "Reactome", "description": "SCF(Skp2)-mediated degradation of p27/p21" }, { "id": "R-RNO-195253", "name": "Degradation of beta-catenin by the destruction complex", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-195253", "resource": "Reactome", "description": "Degradation of beta-catenin by the destruction complex" }, { "id": "R-RNO-2467813", "name": "Separation of Sister Chromatids", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2467813", "resource": "Reactome", "description": "Separation of Sister Chromatids" }, { "id": "R-RNO-349425", "name": "Autodegradation of the E3 ubiquitin ligase COP1", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-349425", "resource": "Reactome", "description": "Autodegradation of the E3 ubiquitin ligase COP1" }, { "id": "R-RNO-350562", "name": "Regulation of ornithine decarboxylase (ODC)", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-350562", "resource": "Reactome", "description": "Regulation of ornithine decarboxylase (ODC)" }, { "id": "R-RNO-382556", "name": "ABC-family proteins mediated transport", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-382556", "resource": "Reactome", "description": "ABC-family proteins mediated transport" }, { "id": "R-RNO-450408", "name": "AUF1 (hnRNP D0) binds and destabilizes mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-450408", "resource": "Reactome", "description": "AUF1 (hnRNP D0) binds and destabilizes mRNA" }, { "id": "R-RNO-4608870", "name": "Asymmetric localization of PCP proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4608870", "resource": "Reactome", "description": "Asymmetric localization of PCP proteins" }, { "id": "R-RNO-4641257", "name": "Degradation of AXIN", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4641257", "resource": "Reactome", "description": "Degradation of AXIN" }, { "id": "R-RNO-4641258", "name": "Degradation of DVL", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4641258", "resource": "Reactome", "description": "Degradation of DVL" }, { "id": "R-RNO-5358346", "name": "Hedgehog ligand biogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5358346", "resource": "Reactome", "description": "Hedgehog ligand biogenesis" }, { "id": "R-RNO-5607761", "name": "Dectin-1 mediated noncanonical NF-kB signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5607761", "resource": "Reactome", "description": "Dectin-1 mediated noncanonical NF-kB signaling" }, { "id": "R-RNO-5610780", "name": "Degradation of GLI1 by the proteasome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5610780", "resource": "Reactome", "description": "Degradation of GLI1 by the proteasome" }, { "id": "R-RNO-5610785", "name": "GLI3 is processed to GLI3R by the proteasome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5610785", "resource": "Reactome", "description": "GLI3 is processed to GLI3R by the proteasome" }, { "id": "R-RNO-5632684", "name": "Hedgehog 'on' state", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5632684", "resource": "Reactome", "description": "Hedgehog 'on' state" }, { "id": "R-RNO-5658442", "name": "Regulation of RAS by GAPs", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5658442", "resource": "Reactome", "description": "Regulation of RAS by GAPs" }, { "id": "R-RNO-5668541", "name": "TNFR2 non-canonical NF-kB pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5668541", "resource": "Reactome", "description": "TNFR2 non-canonical NF-kB pathway" }, { "id": "R-RNO-5676590", "name": "NIK-->noncanonical NF-kB signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5676590", "resource": "Reactome", "description": "NIK-->noncanonical NF-kB signaling" }, { "id": "R-RNO-5687128", "name": "MAPK6/MAPK4 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5687128", "resource": "Reactome", "description": "MAPK6/MAPK4 signaling" }, { "id": "R-RNO-5689603", "name": "UCH proteinases", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5689603", "resource": "Reactome", "description": "UCH proteinases" }, { "id": "R-RNO-5689880", "name": "Ub-specific processing proteases", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5689880", "resource": "Reactome", "description": "Ub-specific processing proteases" }, { "id": "R-RNO-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-RNO-68867", "name": "Assembly of the pre-replicative complex", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-68867", "resource": "Reactome", "description": "Assembly of the pre-replicative complex" }, { "id": "R-RNO-68949", "name": "Orc1 removal from chromatin", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-68949", "resource": "Reactome", "description": "Orc1 removal from chromatin" }, { "id": "R-RNO-69017", "name": "CDK-mediated phosphorylation and removal of Cdc6", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-69017", "resource": "Reactome", "description": "CDK-mediated phosphorylation and removal of Cdc6" }, { "id": "R-RNO-69481", "name": "G2/M Checkpoints", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-69481", "resource": "Reactome", "description": "G2/M Checkpoints" }, { "id": "R-RNO-69601", "name": "Ubiquitin Mediated Degradation of Phosphorylated Cdc25A", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-69601", "resource": "Reactome", "description": "Ubiquitin Mediated Degradation of Phosphorylated Cdc25A" }, { "id": "R-RNO-75815", "name": "Ubiquitin-dependent degradation of Cyclin D", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-75815", "resource": "Reactome", "description": "Ubiquitin-dependent degradation of Cyclin D" }, { "id": "R-RNO-8852276", "name": "The role of GTSE1 in G2/M progression after G2 checkpoint", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8852276", "resource": "Reactome", "description": "The role of GTSE1 in G2/M progression after G2 checkpoint" }, { "id": "R-RNO-8854050", "name": "FBXL7 down-regulates AURKA during mitotic entry and in early mitosis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8854050", "resource": "Reactome", "description": "FBXL7 down-regulates AURKA during mitotic entry and in early mitosis" }, { "id": "R-RNO-8939236", "name": "RUNX1 regulates transcription of genes involved in differentiation of HSCs", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8939236", "resource": "Reactome", "description": "RUNX1 regulates transcription of genes involved in differentiation of HSCs" }, { "id": "R-RNO-8941858", "name": "Regulation of RUNX3 expression and activity", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8941858", "resource": "Reactome", "description": "Regulation of RUNX3 expression and activity" }, { "id": "R-RNO-8948751", "name": "Regulation of PTEN stability and activity", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8948751", "resource": "Reactome", "description": "Regulation of PTEN stability and activity" }, { "id": "R-RNO-8951664", "name": "Neddylation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8951664", "resource": "Reactome", "description": "Neddylation" }, { "id": "R-RNO-9755511", "name": "KEAP1-NFE2L2 pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9755511", "resource": "Reactome", "description": "KEAP1-NFE2L2 pathway" }, { "id": "R-RNO-9762114", "name": "GSK3B and BTRC:CUL1-mediated-degradation of NFE2L2", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9762114", "resource": "Reactome", "description": "GSK3B and BTRC:CUL1-mediated-degradation of NFE2L2" }, { "id": "R-RNO-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983168", "resource": "Reactome", "description": "Antigen processing: Ubiquitination & Proteasome degradation" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "metallopeptidase activity", "id": "GO:0008237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008237", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZM79", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM79" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZM79", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM79" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZM79", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM79" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "proteasome complex", "id": "GO:0000502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000502", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZM79", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM79" } ], "pmid": "" }, { "name": "proteasome regulatory particle", "id": "GO:0005838", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005838", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZM79", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM79" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }