{ "uniprot_canonical_ac": "A0A8I5ZM63-1", "uniprot_ac": "A0A8I5ZM63", "uniprot_id": "A0A8I5ZM63_RAT", "mass": { "chemical_mass": 47780.0, "monoisotopic_mass": 47780.0 }, "refseq": {}, "gene_names": [ { "name": "LOC102555217", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM63", "id": "A0A8I5ZM63" } ], "protein_names": [ { "name": "Zinc finger protein 120-like", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A8I5ZM63" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZM63", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM63" } ], "common_name": "Rat" } ], "gene": [ { "name": "LOC102555217", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM63", "locus": { "chromosome": "3", "start_pos": 138627354, "end_pos": 138596796, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000065630", "url": "https://www.ensembl.org/id/ENSRNOG00000065630" } ] } } ], "crossref": [ { "id": "cd07765", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07765", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001909", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001909", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036051", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036051", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "CEAFAYN", "url": "https://omabrowser.org/oma/group/CEAFAYN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR23226", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23226", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23226:SF298", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23226:SF298", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00096", "url": "http://pfam.xfam.org/family/PF00096", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01352", "url": "http://pfam.xfam.org/family/PF01352", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13912", "url": "http://pfam.xfam.org/family/PF13912", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "7717583", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=7717583", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I5ZM63", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM63", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZM63-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM63-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZZG7", "url": "https://www.uniprot.org/uniprot/A0A8I5ZZG7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZZG7-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZZG7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AHP9", "url": "https://www.uniprot.org/uniprot/A0A8I6AHP9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AHP9-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AHP9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "GIVTYDDVHVHFTQEEWALLDPSQKSLYKDVMLETYRNLTAIGYVWEDHNIEERFQSSRRYGRHTRSLTKEQLSEFIQCGKTSTFQSHNQRQERIHTGEKPYEGVQHCEAFAYRSSLHIHKTKLGREKPYECNQCGKDFASHSCLQRHKRVHKGEKSHECSQSGKALGCQSGLQYHKRTHTGEKPYKCNQCGEAFVYHSDLQKHKRTHTGQKSFKCSQCGKAFSGNRHLLRHKRIHTGEKPYECNQCGKDFSQHSSLQRHKRIHTGEKPYECKQCGKGFACQSGLYIHKRTHTGEKPYECNQCDKAFACQSGLLYHKRTHTGERPYECNECGKAFIHHSHFQTHKRTHTGEKPFECDQCGKAFARNNHLLTHRRIHTREKLYERKKGGKPLASHSSLQVHKRTLTGEKPY", "length": 410, "header": "tr|A0A8I5ZM63-1|A0A8I5ZM63_RAT Isoform 1 of Zinc finger protein 120-like OS=Rattus norvegicus OX=10116 GN=LOC102555217 PE=4 SV=1 CANONICAL=A0A8I5ZM63-1" }, "isoforms": [ { "isoform_ac": "A0A8I5ZM63-1", "url": "", "sequence": { "sequence": "GIVTYDDVHVHFTQEEWALLDPSQKSLYKDVMLETYRNLTAIGYVWEDHNIEERFQSSRRYGRHTRSLTKEQLSEFIQCGKTSTFQSHNQRQERIHTGEKPYEGVQHCEAFAYRSSLHIHKTKLGREKPYECNQCGKDFASHSCLQRHKRVHKGEKSHECSQSGKALGCQSGLQYHKRTHTGEKPYKCNQCGEAFVYHSDLQKHKRTHTGQKSFKCSQCGKAFSGNRHLLRHKRIHTGEKPYECNQCGKDFSQHSSLQRHKRIHTGEKPYECKQCGKGFACQSGLYIHKRTHTGEKPYECNQCDKAFACQSGLLYHKRTHTGERPYECNECGKAFIHHSHFQTHKRTHTGEKPFECDQCGKAFARNNHLLTHRRIHTREKLYERKKGGKPLASHSSLQVHKRTLTGEKPY", "length": 410, "header": "tr|A0A8I5ZM63-1|A0A8I5ZM63_RAT Isoform 1 of Zinc finger protein 120-like OS=Rattus norvegicus OX=10116 GN=LOC102555217 PE=4 SV=1 CANONICAL=A0A8I5ZM63-1" }, "locus": { "chromosome": "3", "start_pos": 138624013, "end_pos": 138621277, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000105216.1", "url": "https://www.ensembl.org/id/ENSRNOT00000105216.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000079170.1", "url": "https://www.ensembl.org/id/ENSRNOP00000079170.1" } ] } }, { "isoform_ac": "A0A8I5ZZG7-1", "url": "", "sequence": { "sequence": "MYESFQICVCRHTRSLTKEQLSEFIQCGKTSTFQSHNQRQERIHTGEKPYEGVQHCEAFAYRSSLHIHKTKLGREKPYECNQCGKDFASHSCLQRHKRVHKGEKSHECSQSGKALGCQSGLQYHKRTHTGEKPYKCNQCGEAFVYHSDLQKHKRTHTGQKSFKCSQCGKAFSGNRHLLRHKRIHTGEKPYECNQCGKDFSQHSSLQRHKRIHTGEKPYECKQCGKGFACQSGLYIHKRTHTGEKPYECNQCDKAFACQSGLLYHKRTHTGERPYECNECGKAFIHHSHFQTHKRTHTGEKPFECDQCGKAFARNNHLLTHRRIHTREKLYERKKGGKPLASHSSLQVHKRTLTGEKPY", "length": 358, "header": "tr|A0A8I5ZZG7-1|A0A8I5ZZG7_RAT Computationally mapped isoform of Zinc finger protein 120-like OS=Rattus norvegicus OX=10116 GN=LOC102555217 PE=4 SV=1 CANONICAL=A0A8I5ZM63-1" }, "locus": { "chromosome": "3", "start_pos": 138624013, "end_pos": 138622940, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000108162.1", "url": "https://www.ensembl.org/id/ENSRNOT00000108162.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000085121.1", "url": "https://www.ensembl.org/id/ENSRNOP00000085121.1" } ] } }, { "isoform_ac": "A0A8I6AHP9-1", "url": "", "sequence": { "sequence": "MLETYRNLTAIGYVWEDHNIEERFQSSRRYGRHTRSLTKEQLSEFIQCGKTSTFQSHNQRQERIHTGEKPYEGVQHCEAFAYRSSLHIHKTKLGREKPYECNQCGKDFASHSCLQRHKRVHKGEKSHECSQSGKALGCQSGLQYHKRTHTGEKPYKCNQCGEAFVYHSDLQKHKRTHTGQKSFKCSQCGKAFSGNRHLLRHKRIHTGEKPYECNQCGKDFSQHSSLQRHKRIHTGEKPYECKQCGKGFACQSGLYIHKRTHTGEKPYECNQCDKAFACQSGLLYHKRTHTGERPYECNECGKAFIHHSHFQTHKRTHTGEKPFECDQCGKAFARNNHLLTHRRIHTREKLYERKKGGKPLASHSSLQVHKRTLTGEKPY", "length": 379, "header": "tr|A0A8I6AHP9-1|A0A8I5ZM63_RAT Computationally mapped isoform of Zinc finger protein 120-like OS=Rattus norvegicus OX=10116 GN=LOC102555217 PE=4 SV=1 CANONICAL=A0A8I5ZM63-1" }, "locus": { "chromosome": "3", "start_pos": 138624013, "end_pos": 138621370, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000106218.1", "url": "https://www.ensembl.org/id/ENSRNOT00000106218.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000094414.1", "url": "https://www.ensembl.org/id/ENSRNOP00000094414.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZM63", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM63" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZM63", "url": "https://www.uniprot.org/uniprot/A0A8I5ZM63" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 38, "end_pos": 40, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }