{ "uniprot_canonical_ac": "A0A8I5ZL85-1", "uniprot_ac": "A0A8I5ZL85", "uniprot_id": "A0A8I5ZL85_RAT", "mass": { "chemical_mass": 35409.0, "monoisotopic_mass": 35409.0 }, "refseq": {}, "gene_names": [ { "name": "Ackr1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A8I5ZL85", "id": "A0A8I5ZL85" } ], "protein_names": [ { "name": "Atypical chemokine receptor 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A8I5ZL85" }, { "name": "Duffy antigen/chemokine receptor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A8I5ZL85" } ], "function": [ { "annotation": "Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1 and TARC. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels.", "evidence": [ { "database": "UniProtKB", "id": "A0A8I6AQG3", "url": "https://www.uniprot.org/uniprot/A0A8I6AQG3#function" }, { "database": "UniProtKB", "id": "RU368070", "url": "https://www.uniprot.org/uniprot/RU368070#function" }, { "database": "UniProtKB", "id": "A0A8I5ZL85", "url": "https://www.uniprot.org/uniprot/A0A8I5ZL85#function" } ] } ], "disease": [ { "disease_id": "DOID:12365", "recommended_name": { "id": "DOID:12365", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12365", "name": "malaria", "description": "A parasitic protozoa infectious disease characterized as a vector-borne infectious disease caused by the presence of protozoan parasites of the genus Plasmodium in the red blood cells, transmitted from an infected to an uninfected individual by the bite of anopheline mosquitoes, and characterized by periodic attacks of chills and fever that coincide with mass destruction of blood cells and the release of toxic substances by the parasite at the end of each reproductive cycle." }, "synonyms": [ { "id": "DOID:12365", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12365", "name": "induced malaria", "description": "" } ], "evidence": [ { "id": "12365", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12365" } ] }, { "disease_id": "DOID:12978", "recommended_name": { "id": "DOID:12978", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12978", "name": "Plasmodium vivax malaria", "description": "A malaria that is caused by the protozoan parasite Plasmodium vivax, which induces paroxysms at 48-hour intervals." }, "synonyms": [ { "id": "DOID:12978", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12978", "name": "Malaria by Plasmodium vivax", "description": "" }, { "id": "DOID:12978", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12978", "name": "Vivax Malaria", "description": "" } ], "evidence": [ { "id": "12978", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12978" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZL85", "url": "https://www.uniprot.org/uniprot/A0A8I5ZL85" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ackr1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZL85", "locus": { "chromosome": "13", "start_pos": 85782398, "end_pos": 85783983, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000069330", "url": "https://www.ensembl.org/id/ENSRNOG00000069330" } ] } } ], "crossref": [ { "id": "cd15010", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15010", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR005384", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005384", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "VWYSSAF", "url": "https://omabrowser.org/oma/group/VWYSSAF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR14181", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14181", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14181:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14181:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "XP_002724939", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002724939", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1596198", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1596198", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I5ZL85", "url": "https://www.uniprot.org/uniprot/A0A8I5ZL85", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZL85-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZL85-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AQG3", "url": "https://www.uniprot.org/uniprot/A0A8I6AQG3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AQG3-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AQG3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGNCLHPVERFSVDNSRTQFTFENWNYSYEDNASYELTDDYNLTGAAPCYSCNLLDSSSLPFFILTSVLGLLASGGILFTILRPFFHWQICPSWPILAQLAVGSALFSISVTILAPGLYSAHSTALCNLGYWAWYTAAFAQALFIGCYVFLNPSLNIVQIPGLTLGLTVGLWGAAALLGLPVALASDVYDGLCTLPSYRNLETLKYIHSAICFTIFTVLPLTLLAAKGLKTALGKGPGPWVSVLWLWFIFWWPHGMVLMFDALVRSKAMLLQTCQSQKMLDVMLDVAEALAMLHCVATPLLLALFCHQTTRRSLPSLSLPAR", "length": 322, "header": "tr|A0A8I5ZL85-1|A0A8I5ZL85_RAT Isoform 1 of Atypical chemokine receptor 1 OS=Rattus norvegicus OX=10116 GN=Ackr1 PE=3 SV=1 CANONICAL=A0A8I5ZL85-1" }, "isoforms": [ { "isoform_ac": "A0A8I5ZL85-1", "url": "", "sequence": { "sequence": "MGNCLHPVERFSVDNSRTQFTFENWNYSYEDNASYELTDDYNLTGAAPCYSCNLLDSSSLPFFILTSVLGLLASGGILFTILRPFFHWQICPSWPILAQLAVGSALFSISVTILAPGLYSAHSTALCNLGYWAWYTAAFAQALFIGCYVFLNPSLNIVQIPGLTLGLTVGLWGAAALLGLPVALASDVYDGLCTLPSYRNLETLKYIHSAICFTIFTVLPLTLLAAKGLKTALGKGPGPWVSVLWLWFIFWWPHGMVLMFDALVRSKAMLLQTCQSQKMLDVMLDVAEALAMLHCVATPLLLALFCHQTTRRSLPSLSLPAR", "length": 322, "header": "tr|A0A8I5ZL85-1|A0A8I5ZL85_RAT Isoform 1 of Atypical chemokine receptor 1 OS=Rattus norvegicus OX=10116 GN=Ackr1 PE=3 SV=1 CANONICAL=A0A8I5ZL85-1" }, "locus": { "chromosome": "13", "start_pos": 85783905, "end_pos": 85782496, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000117393.1", "url": "https://www.ensembl.org/id/ENSRNOT00000117393.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000078656.1", "url": "https://www.ensembl.org/id/ENSRNOP00000078656.1" } ] } }, { "isoform_ac": "A0A8I6AQG3-1", "url": "", "sequence": { "sequence": "MGNCLHPVERFSVDNSRTQFTFENWNYSYEDNASYELTDDYNLTGAAPCYSCNLLDSSSLPFFILTSVLGLLASGGILFTILRPFFHWQICPSWPILAQLAVGSALFSISVTILAPGLYSAHSTALCNLGYWESGNFEVHTFCHLFYHLHGIATDSFGSQGAEDSIGQGARPLG", "length": 174, "header": "tr|A0A8I6AQG3-1|A0A8I5ZL85_RAT Computationally mapped isoform of Atypical chemokine receptor 1 OS=Rattus norvegicus OX=10116 GN=Ackr1 PE=3 SV=1 CANONICAL=A0A8I5ZL85-1" }, "locus": { "chromosome": "13", "start_pos": 85783905, "end_pos": 85782740, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000095663.1", "url": "https://www.ensembl.org/id/ENSRNOT00000095663.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000095417.1", "url": "https://www.ensembl.org/id/ENSRNOP00000095417.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZL85", "url": "https://www.uniprot.org/uniprot/A0A8I5ZL85" } ], "pmid": "" }, { "name": "C-C chemokine binding", "id": "GO:0019957", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019957", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZL85", "url": "https://www.uniprot.org/uniprot/A0A8I5ZL85" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZL85", "url": "https://www.uniprot.org/uniprot/A0A8I5ZL85" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZL85", "url": "https://www.uniprot.org/uniprot/A0A8I5ZL85" } ], "pmid": "" }, { "name": "recycling endosome", "id": "GO:0055037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055037", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZL85", "url": "https://www.uniprot.org/uniprot/A0A8I5ZL85" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZL85", "url": "https://www.uniprot.org/uniprot/A0A8I5ZL85" } ], "pmid": "" }, { "name": "regulation of chemokine production", "id": "GO:0032642", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032642", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZL85", "url": "https://www.uniprot.org/uniprot/A0A8I5ZL85" } ], "pmid": "" }, { "name": "chemokine-mediated signaling pathway", "id": "GO:0070098", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070098", "evidence": [ { "database": "UniProtKB", "id": "A0A8I5ZL85", "url": "https://www.uniprot.org/uniprot/A0A8I5ZL85" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 26, "end_pos": 28, "annotation": "n_glycosylation_sequon" }, { "start_pos": 32, "end_pos": 34, "annotation": "n_glycosylation_sequon" }, { "start_pos": 42, "end_pos": 44, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }