{ "uniprot_canonical_ac": "A0A5F9ZHS7-1", "uniprot_ac": "A0A5F9ZHS7", "uniprot_id": "NFILZ_HUMAN", "mass": { "chemical_mass": 31047.0, "monoisotopic_mass": 31047.0 }, "refseq": {}, "gene_names": [ { "name": "NFILZ", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A5F9ZHS7", "id": "A0A5F9ZHS7" } ], "protein_names": [ { "name": "NFIL3 like protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A5F9ZHS7" }, { "name": "NFIL3 like basic leucine zipper", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A5F9ZHS7" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A5F9ZHS7", "url": "https://www.uniprot.org/uniprot/A0A5F9ZHS7" } ], "common_name": "Human" } ], "gene": [ { "name": "NFILZ", "url": "https://www.uniprot.org/uniprot/A0A5F9ZHS7", "locus": { "chromosome": "19", "start_pos": 8681151, "end_pos": 8630633, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000268480", "url": "https://www.ensembl.org/id/ENSG00000268480" } ] } } ], "crossref": [ { "id": "ENSG00000268480", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000268480", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd14694", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14694", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "NFILZ", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NFILZ", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "52681", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=52681", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR004827", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004827", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046347", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046347", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047229", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047229", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_A0A5F9ZHS7", "url": "https://www.nextprot.org/entry/NX_A0A5F9ZHS7", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "TCPVPGN", "url": "https://omabrowser.org/oma/group/TCPVPGN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4467729at2759", "url": "http://www.orthodb.org/?query=4467729at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15284", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15284", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15284:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15284:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07716", "url": "http://pfam.xfam.org/family/PF07716", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A5F9ZHS7", "url": "http://purl.obolibrary.org/obo/PR_A0A5F9ZHS7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_016855268", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_016855268", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A5F9ZHS7", "url": "https://www.uniprot.org/uniprot/A0A5F9ZHS7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A5F9ZHS7-1", "url": "https://www.uniprot.org/uniprot/A0A5F9ZHS7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDVGFSGLPDVSQSHSKTLWGARGRGPSIRRQREFMPEEKKDTVYWEKRRKNNEAAKRSREKRRLNDAAIEGRLAALMEENALLKGELKALKLRFGLLPLTGGPRALPLQALLLEAPWTGDPRPGAEALSSLSGSHSCLLRPRSLDAGIPGCRGCLLAPRWTGLATSPRSPQESASPTLNRIDMALQTALPPALFSCHLLEGHVGSRPELRPCWGLWSPVPSGCRASGPSDVLLTPTADPMGLSPGVTCPAPGNSPEGLGQPSLPHKLRIKSRASGRVPRGWEGGQAPL", "length": 289, "header": "sp|A0A5F9ZHS7-1|NFILZ_HUMAN Isoform 1 of NFIL3 like protein OS=Homo sapiens OX=9606 GN=NFILZ PE=3 SV=1 CANONICAL=A0A5F9ZHS7-1" }, "isoforms": [ { "isoform_ac": "A0A5F9ZHS7-1", "url": "", "sequence": { "sequence": "MDVGFSGLPDVSQSHSKTLWGARGRGPSIRRQREFMPEEKKDTVYWEKRRKNNEAAKRSREKRRLNDAAIEGRLAALMEENALLKGELKALKLRFGLLPLTGGPRALPLQALLLEAPWTGDPRPGAEALSSLSGSHSCLLRPRSLDAGIPGCRGCLLAPRWTGLATSPRSPQESASPTLNRIDMALQTALPPALFSCHLLEGHVGSRPELRPCWGLWSPVPSGCRASGPSDVLLTPTADPMGLSPGVTCPAPGNSPEGLGQPSLPHKLRIKSRASGRVPRGWEGGQAPL", "length": 289, "header": "sp|A0A5F9ZHS7-1|NFILZ_HUMAN Isoform 1 of NFIL3 like protein OS=Homo sapiens OX=9606 GN=NFILZ PE=3 SV=1 CANONICAL=A0A5F9ZHS7-1" }, "locus": { "chromosome": "19", "start_pos": 8677632, "end_pos": 8676766, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000570582.4", "url": "https://www.ensembl.org/id/ENST00000570582.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000500121.1", "url": "https://www.ensembl.org/id/ENSP00000500121.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A0A5F9ZHS7", "url": "https://www.uniprot.org/uniprot/A0A5F9ZHS7" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "A0A5F9ZHS7", "url": "https://www.uniprot.org/uniprot/A0A5F9ZHS7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A5F9ZHS7", "url": "https://www.uniprot.org/uniprot/A0A5F9ZHS7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "A0A5F9ZHS7", "url": "https://www.uniprot.org/uniprot/A0A5F9ZHS7" } ], "pmid": "" }, { "name": "circadian rhythm", "id": "GO:0007623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007623", "evidence": [ { "database": "UniProtKB", "id": "A0A5F9ZHS7", "url": "https://www.uniprot.org/uniprot/A0A5F9ZHS7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }