{ "uniprot_canonical_ac": "A0A571BES4-1", "uniprot_ac": "A0A571BES4", "uniprot_id": "A0A571BES4_MOUSE", "mass": { "chemical_mass": 16117.0, "monoisotopic_mass": 16117.0 }, "refseq": { "ac": "NP_001243450", "name": "transmembrane protein 250", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243450" }, "gene_names": [ { "name": "Tmem250-ps", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A571BES4", "id": "A0A571BES4" }, { "name": "C330006A16Rik; Tmem250-ps", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243450", "id": "NP_001243450" }, { "name": "Tmem250", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243450", "id": "NP_001243450" } ], "protein_names": [ { "name": "Transmembrane protein 250, pseudogene", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A571BES4" }, { "name": "transmembrane protein 250, pseudogene", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243450", "id": "NP_001243450" }, { "name": "transmembrane protein 250", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243450", "id": "NP_001243450" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Tmem250-ps", "url": "https://www.uniprot.org/uniprot/A0A571BES4", "locus": { "chromosome": "2", "start_pos": 26026826, "end_pos": 26030533, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000087679", "url": "https://www.ensembl.org/id/ENSMUSG00000087679" } ] } } ], "crossref": [ { "id": "ENSMUSG00000087679", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000087679", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "109299", "url": "https://www.ncbi.nlm.nih.gov/gene/109299", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR041156", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041156", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:109299", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:109299", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1924939", "url": "http://www.informatics.jax.org/marker/MGI:1924939", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "HVTMFLV", "url": "https://omabrowser.org/oma/group/HVTMFLV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5395625at2759", "url": "http://www.orthodb.org/?query=5395625at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PF17685", "url": "http://pfam.xfam.org/family/PF17685", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001243450", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001243450", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A571BES4-1", "url": "https://www.uniprot.org/uniprot/A0A571BES4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPVMPIPRRVRSFHGPHTTCLHAACGPLRTSHLARTKYNNFDVYVKTRWLYGFIRFLLYFSCSLFTAALWGALAALFCLQYLGVRVLLRFQLKLSVLLLLLGRRRVDFRLMNELLIYGIHVTMLLVGGLGWCFMVFVDM", "length": 139, "header": "tr|A0A571BES4-1|A0A571BES4_MOUSE Isoform 1 of Transmembrane protein 250, pseudogene OS=Mus musculus OX=10090 GN=Tmem250-ps PE=4 SV=1 CANONICAL=A0A571BES4-1" }, "isoforms": [ { "isoform_ac": "A0A571BES4-1", "url": "", "sequence": { "sequence": "MPVMPIPRRVRSFHGPHTTCLHAACGPLRTSHLARTKYNNFDVYVKTRWLYGFIRFLLYFSCSLFTAALWGALAALFCLQYLGVRVLLRFQLKLSVLLLLLGRRRVDFRLMNELLIYGIHVTMLLVGGLGWCFMVFVDM", "length": 139, "header": "tr|A0A571BES4-1|A0A571BES4_MOUSE Isoform 1 of Transmembrane protein 250, pseudogene OS=Mus musculus OX=10090 GN=Tmem250-ps PE=4 SV=1 CANONICAL=A0A571BES4-1" }, "locus": { "chromosome": "2", "start_pos": 26028814, "end_pos": 26028398, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000133808.2", "url": "https://www.ensembl.org/id/ENSMUST00000133808.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000158596.2", "url": "https://www.ensembl.org/id/ENSMUSP00000158596.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "mmu:109299", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:109299", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "B2GNF0-1", "protein_name": "Transmembrane protein 250", "gene_name": "Tmem250", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPVMPIPRRVRSFHGPHTTCLHAACGPVRTSHLARTKYNNFDVYVKTRWLYGFIRFLLYFSCSLFTAALWGALAALFCLQYLGVRVLLRFQLKLSVLLLLLGRRRVDFRFMNELLIYGIHVTMLLVGGLGWCFMVFVDM", "length": 139 }, "evidence": [ { "id": "45244067", "url": "http://www.informatics.jax.org/homology/45244067", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "H0YL14-1", "protein_name": "Transmembrane protein 250", "gene_name": "TMEM250", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPVMPIPRRVRSFHGPHTTCLHAACGPVRASHLARTKYNNFDVYIKTRWLYGFIRFLLYFSCSLFTAALWGALAALFCLQYLGVRVLLRFQRKLSVLLLLLGRRRVDFRLVNELLVYGIHVTMLLVGGLGWCFMVFVDM", "length": 139 }, "evidence": [ { "id": "45244067", "url": "http://www.informatics.jax.org/homology/45244067", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "molecular adaptor activity", "id": "GO:0060090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060090", "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "pmid": "" }, { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "septin ring", "id": "GO:0005940", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005940", "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "pmid": "" }, { "name": "microtubule cytoskeleton", "id": "GO:0015630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015630", "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "pmid": "" }, { "name": "septin complex", "id": "GO:0031105", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031105", "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "pmid": "" }, { "name": "cell division site", "id": "GO:0032153", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032153", "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "pmid": "" }, { "name": "cilium assembly", "id": "GO:0060271", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060271", "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "pmid": "" }, { "name": "cytoskeleton-dependent cytokinesis", "id": "GO:0061640", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061640", "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "pmid": "" }, { "name": "positive regulation of viral process", "id": "GO:0048524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048524", "evidence": [ { "database": "UniProtKB", "id": "A0A571BES4", "url": "https://www.uniprot.org/uniprot/A0A571BES4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }