{ "uniprot_canonical_ac": "A0A4Z3-1", "uniprot_ac": "A0A4Z3", "uniprot_id": "A3LT2_RAT", "mass": { "chemical_mass": 39548.0, "monoisotopic_mass": 39548.0 }, "refseq": { "ac": "NP_612533", "name": "alpha-1,3-galactosyltransferase 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_612533" }, "gene_names": [ { "name": "A3galt2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A4Z3", "id": "A0A4Z3" }, { "name": "A3galt2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_612533", "id": "NP_612533" } ], "protein_names": [ { "name": "Alpha-1,3-galactosyltransferase 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A4Z3" }, { "name": "2.4.1.87", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A4Z3" }, { "name": "Isoglobotriaosylceramide synthase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A4Z3" }, { "name": "alpha-1,3-galactosyltransferase 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_612533", "id": "NP_612533" }, { "name": "iGb3 synthase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A4Z3" }, { "name": "iGb3S; isoglobotriaosylceramide synthase; iGb3 synthase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_612533", "id": "NP_612533" }, { "name": "iGb3S", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A4Z3" } ], "function": [ { "annotation": "Synthesizes the galactose-alpha(1,3)-galactose group on the glycosphingolipid isoglobotrihexosylceramide or isogloboside 3 (iGb3) by catalyzing the transfer of galactose from UDP-Galactose to its acceptor molecule Gal-beta-1,4-Glc-ceramide. Can also catalyze the addition of galactose to iGb3 itself to form polygalactose structures. Synthesis of iGb3 is the initial step in the formation of the isoglobo-series glycolipid pathway and is the precursor to isogloboside 4 (iGb4) and isoForssman glycolipids. Can glycosylate only lipids and not proteins and is solely responsible for initiating the synthesis of isoglobo-series glycosphingolipids.", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3#function" }, { "database": "PubMed", "id": "12626403", "url": "https://glygen.org/publication/PubMed/12626403" }, { "database": "PubMed", "id": "17206613", "url": "https://glygen.org/publication/PubMed/17206613" }, { "database": "PubMed", "id": "10854427", "url": "https://glygen.org/publication/PubMed/10854427" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 187, "end_pos": 187, "sequence_org": "L", "sequence_mut": "P", "comment": "Significant loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" }, { "database": "PubMed", "id": "18630988", "url": "https://glygen.org/publication/PubMed/18630988" } ] }, { "start_pos": 198, "end_pos": 200, "sequence_org": "DVD", "sequence_mut": "AVA", "comment": "Catalytically inactive.", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" }, { "database": "PubMed", "id": "10854427", "url": "https://glygen.org/publication/PubMed/10854427" } ] }, { "start_pos": 252, "end_pos": 252, "sequence_org": "Y", "sequence_mut": "N", "comment": "Complete loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" }, { "database": "PubMed", "id": "18630988", "url": "https://glygen.org/publication/PubMed/18630988" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "common_name": "Rat" } ], "gene": [ { "name": "A3galt2", "url": "https://www.uniprot.org/uniprot/A0A4Z3", "locus": { "chromosome": "5", "start_pos": 141115641, "end_pos": 141107983, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000005935", "url": "https://www.ensembl.org/id/ENSRNOG00000005935" } ] } } ], "crossref": [ { "id": "ENSRNOG00000005935", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000005935", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "GT6", "url": "http://www.cazy.org/GT6.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "cd02515", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02515", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "171553", "url": "https://www.ncbi.nlm.nih.gov/gene/171553", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR005076", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005076", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029044", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029044", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:171553", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:171553", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "RFVFCMD", "url": "https://omabrowser.org/oma/group/RFVFCMD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4223357at2759", "url": "http://www.orthodb.org/?query=4223357at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10462", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10462", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10462:SF33", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10462:SF33", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03414", "url": "http://pfam.xfam.org/family/PF03414", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A4Z3", "url": "http://purl.obolibrary.org/obo/PR_A0A4Z3", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_612533", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_612533", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "727913", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=727913", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "13013", "url": "https://www.rhea-db.org/rhea/13013", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "42000", "url": "https://www.rhea-db.org/rhea/42000", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "56740", "url": "https://www.rhea-db.org/rhea/56740", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A4Z3-1", "url": "https://www.uniprot.org/uniprot/A0A4Z3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2Q356", "url": "https://www.uniprot.org/uniprot/A0A8L2Q356", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2Q356-1", "url": "https://www.uniprot.org/uniprot/A0A8L2Q356-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALEGLRAKKRLLWRLFLSAFGLLGLYHYWFKIFRLFEVFIPMGICPMAIMPLLKDNFTGVLRHWARPEVLTCTSWGAPIIWDETFDPHVAEREARRQNLTIGLTVFAVGRYLEKYLEHFLVSAEQYFMVGQNVVYYVFTDRPEAVPHVALGQGRLLRVKPVRREKRWQDVSMARMLTLHEALGGQLGREADYVFCLDVDQYFSGNFGPEVLADLVAQLHAWHFRWPRWMLPYERDKRSAAALSLSEGDFYYHAAVFGGSVAALLKLTAHCATGQQLDREHGIEARWHDESHLNKFFWLSKPTKLLSPEFCWAEEIGWRPEIHHPRLIWAPKEYALVRT", "length": 339, "header": "sp|A0A4Z3-1|A3LT2_RAT Isoform 1 of Alpha-1,3-galactosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=A3galt2 PE=1 SV=1 CANONICAL=A0A4Z3-1" }, "isoforms": [ { "isoform_ac": "A0A4Z3-1", "url": "", "sequence": { "sequence": "MALEGLRAKKRLLWRLFLSAFGLLGLYHYWFKIFRLFEVFIPMGICPMAIMPLLKDNFTGVLRHWARPEVLTCTSWGAPIIWDETFDPHVAEREARRQNLTIGLTVFAVGRYLEKYLEHFLVSAEQYFMVGQNVVYYVFTDRPEAVPHVALGQGRLLRVKPVRREKRWQDVSMARMLTLHEALGGQLGREADYVFCLDVDQYFSGNFGPEVLADLVAQLHAWHFRWPRWMLPYERDKRSAAALSLSEGDFYYHAAVFGGSVAALLKLTAHCATGQQLDREHGIEARWHDESHLNKFFWLSKPTKLLSPEFCWAEEIGWRPEIHHPRLIWAPKEYALVRT", "length": 339, "header": "sp|A0A4Z3-1|A3LT2_RAT Isoform 1 of Alpha-1,3-galactosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=A3galt2 PE=1 SV=1 CANONICAL=A0A4Z3-1" }, "locus": {} }, { "isoform_ac": "A0A8L2Q356-1", "url": "", "sequence": { "sequence": "MQNLKGSALCEFLSWCCVNRRIGSCLQVKQSRKIRQSFLPCKSVSHALPHSHHPRAKKRLLWRLFLSAFGLLGLYHYWFKIFRLFEVFIPMGICPMAIMPLLKDNFTGVLRHWARPEVLTCTSWGAPIIWDETFDPHVAEREARRQNLTIGLTVFAVGRYLEKYLEHFLVSAEQYFMVGQNVVYYVFTDRPEAVPHVALGQGRLLRVKPVRREKRWQDVSMARMLTLHEALGGQLGREADYVFCLDVDQYFSGNFGPEVLADLVAQLHAWHFRWPRWMLPYERDKRSAAALSLSEGDFYYHAAVFGGSVAALLKLTAHCATGQQLDREHGIEARWHDESHLNKFFWLSKPTKLLSPEFCWAEEIGWRPEIHHPRLIWAPKEYALVRT", "length": 387, "header": "tr|A0A8L2Q356-1|A0A8L2Q356_RAT Computationally mapped isoform of Alpha 1,3-galactosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=A3galt2 PE=3 SV=1 CANONICAL=A0A4Z3-1" }, "locus": { "chromosome": "5", "start_pos": 141112943, "end_pos": 141107983, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000007851.6", "url": "https://www.ensembl.org/id/ENSRNOT00000007851.6" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000007851.5", "url": "https://www.ensembl.org/id/ENSRNOP00000007851.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 57, "start_aa": "Asn", "end_pos": 57, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn57", "evidence": [ { "id": "A0A4Z3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A4Z3#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 99, "start_aa": "Asn", "end_pos": 99, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn99", "evidence": [ { "id": "A0A4Z3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A4Z3#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Expression cloning of a new member of the ABO blood group glycosyltransferases, iGb3 synthase, that directs the synthesis of isoglobo-glycosphingolipids.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Keusch JJ, Manzella SM, Nyame KA, Cummings RD, Baenziger JU", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "reference": [ { "type": "PubMed", "id": "10854427", "url": "https://glygen.org/publication/PubMed/10854427" } ] }, { "title": "Characterization of the rat alpha(1,3)galactosyltransferase: evidence for two independent genes encoding glycosyltransferases that synthesize Galalpha(1,3)Gal by two separate glycosylation pathways.", "journal": "Glycobiology", "date": "2003", "authors": "Taylor SG, McKenzie IF, Sandrin MS", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "reference": [ { "type": "PubMed", "id": "12626403", "url": "https://glygen.org/publication/PubMed/12626403" } ] }, { "title": "Enzymes that synthesize the IB4 epitope are not sufficient to impart IB4 binding in dorsal root ganglia of rat.", "journal": "The Journal of comparative neurology", "date": "2007", "authors": "Fullmer JM, Riedl M, Williams FG, Sandrin M, Elde R", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "reference": [ { "type": "PubMed", "id": "17206613", "url": "https://glygen.org/publication/PubMed/17206613" } ] }, { "title": "Humans lack iGb3 due to the absence of functional iGb3-synthase: implications for NKT cell development and transplantation.", "journal": "PLoS biology", "date": "2008", "authors": "Christiansen D, Milland J, Mouhtouris E, Vaughan H, Pellicci DG, McConville MJ, Godfrey DI, Sandrin MS", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "reference": [ { "type": "PubMed", "id": "18630988", "url": "https://glygen.org/publication/PubMed/18630988" } ] } ], "pathway": [ { "id": "rno:171553", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:171553", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q3V1N9-1", "protein_name": "Alpha-1,3-galactosyltransferase 2", "gene_name": "A3galt2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MALGTELGVSWPGSHGSCREQEGQRQRGPGKPTWGLSRAKKRLLWRFFLSAFGFLGLYHYRFIIIRLIEGSIPMGTCPTAIMPLPRDNFTGVLHHWARPEVLTCTSWGAPIIWDGTFDPHVAQQEARRRNLTIGLTVFAVGRYLEKYLEHFLVSAEQHFMVGQNVVYYVFTDRPEAVPYVALGQGRLLRAKPVQRERRWQDVSMARMPTLHEALGGQLGQEADFVFCLDVDQYFTGNFGPEVLADLVAQLHAWHYRWPRWLLPYERDKRSAAALSLSEGDFYYHAAVFGGSVAALLKLTAHCATGQQLDHKRGIEALWHDESHLNKFFWLNKPTKLLSPEFCWAEEIIWRREIHHPRLLWAPKEYTLVRN", "length": 370 }, "evidence": [ { "id": "45240239", "url": "http://www.informatics.jax.org/homology/45240239", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "U3KPV4-1", "protein_name": "Alpha-1,3-galactosyltransferase 2", "gene_name": "A3GALT2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALKEGLRAWKRIFWRQILLTLGLLGLFLYGLPKFRHLEALIPMGVCPSATMSQLRDNFTGALRPWARPEVLTCTPWGAPIIWDGSFDPDVAKQEARQQNLTIGLTIFAVGRYLEKYLERFLETAEQHFMAGQSVMYYVFTELPGAVPRVALGPGRRLPVERVARERRWQDVSMARMRTLHAALGGLPGREAHFMFCMDVDQHFSGTFGPEALAESVAQLHSWHYHWPSWLLPFERDAHSAAAMAWGQGDFYNHAAVFGGSVAALRGLTAHCAGGLDWDRARGLEARWHDESHLNKFFWLHKPAKVLSPEFCWSPDIGPRAEIRRPRLLWAPKGYRLLRN", "length": 340 }, "evidence": [ { "id": "45240239", "url": "http://www.informatics.jax.org/homology/45240239", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "pmid": "" }, { "name": "vesicle", "id": "GO:0031982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031982", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "pmid": "" }, { "name": "Golgi cisterna membrane", "id": "GO:0032580", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032580", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "glycosphingolipid biosynthetic process", "id": "GO:0006688", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006688", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "pmid": "" }, { "name": "carbohydrate metabolic process", "id": "GO:0005975", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005975", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "pmid": "" }, { "name": "lipid glycosylation", "id": "GO:0030259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030259", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "pmid": "" }, { "name": "cellular response to manganese ion", "id": "GO:0071287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071287", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "pmid": "" }, { "name": "glycosyltransferase activity", "id": "GO:0016757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016757", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "pmid": "" }, { "name": "N-acetyllactosaminide 3-alpha-galactosyltransferase activity", "id": "GO:0047276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047276", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "pmid": "" }, { "name": "alpha-1,3-galactosyltransferase activity", "id": "GO:0001962", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001962", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "pmid": "" }, { "name": "hexosyltransferase activity", "id": "GO:0016758", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016758", "evidence": [ { "database": "UniProtKB", "id": "A0A4Z3", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 57, "end_pos": 59, "annotation": "n_glycosylation_sequon" }, { "start_pos": 99, "end_pos": 101, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "13013", "name": "", "equation": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = an alpha-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A4Z3-1", "Q3L7M0-1", "G3V9Q9-1", "U3KPV4-1", "Q3V1N9-1", "P23336-1", "A2AUQ7-1" ], "evidence": [ { "id": "13013", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/13013" } ] }, { "id": "42000", "name": "", "equation": "a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + UDP-alpha-D-galactose = H(+) + isogloboside iGb3Cer (d18:1(4E)) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A4Z3-1", "U3KPV4-1", "Q3V1N9-1" ], "evidence": [ { "id": "42000", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/42000" } ] }, { "id": "56740", "name": "", "equation": "globoside Gb3Cer + UDP-alpha-D-galactose = GalGb3Cer + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A4Z3-1", "U3KPV4-1", "Q3V1N9-1" ], "evidence": [ { "id": "56740", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/56740" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A4Z3", "gene_name": "A3galt2", "activity": [ { "ec_number": "2.4.1.87", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = an alpha-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "A0A4Z3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ] }, { "ec_number": "2.4.1.87", "activity": "", "evidence": [ { "id": "A0A4Z3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A4Z3" } ] } ] }, { "uniprot_ac": "A2AUQ7", "gene_name": "Ggta1l1", "activity": [ { "ec_number": "2.4.1.87", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = an alpha-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "A2AUQ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AUQ7" } ] }, { "ec_number": "2.4.1.87", "activity": "", "evidence": [ { "id": "A2AUQ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AUQ7" } ] } ] }, { "uniprot_ac": "G3V9Q9", "gene_name": "Ggta1l1", "activity": [ { "ec_number": "2.4.1.87", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = an alpha-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "G3V9Q9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V9Q9" } ] }, { "ec_number": "2.4.1.87", "activity": "", "evidence": [ { "id": "G3V9Q9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V9Q9" } ] } ] }, { "uniprot_ac": "P23336", "gene_name": "Ggta1", "activity": [ { "ec_number": "2.4.1.87", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = an alpha-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "P23336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23336" } ] }, { "ec_number": "2.4.1.87", "activity": "", "evidence": [ { "id": "P23336", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23336" } ] } ] }, { "uniprot_ac": "Q3L7M0", "gene_name": "Ggta1", "activity": [ { "ec_number": "2.4.1.87", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = an alpha-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q3L7M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3L7M0" } ] }, { "ec_number": "2.4.1.87", "activity": "", "evidence": [ { "id": "Q3L7M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3L7M0" } ] } ] }, { "uniprot_ac": "Q3V1N9", "gene_name": "A3galt2", "activity": [ { "ec_number": "2.4.1.87", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = an alpha-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q3V1N9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3V1N9" } ] }, { "ec_number": "2.4.1.87", "activity": "", "evidence": [ { "id": "Q3V1N9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3V1N9" } ] } ] }, { "uniprot_ac": "U3KPV4", "gene_name": "A3GALT2", "activity": [ { "ec_number": "2.4.1.87", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = an alpha-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "U3KPV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/U3KPV4" } ] }, { "ec_number": "2.4.1.87", "activity": "", "evidence": [ { "id": "U3KPV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/U3KPV4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }