{
    "uniprot_canonical_ac": "A0A494C103-1",
    "uniprot_ac": "A0A494C103",
    "uniprot_id": "SPADH_HUMAN",
    "mass": {
        "chemical_mass": 15323.0,
        "monoisotopic_mass": 15323.0
    },
    "refseq": {},
    "gene_names": [
        {
            "name": "SPADH",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A0A494C103",
            "id": "A0A494C103"
        }
    ],
    "protein_names": [
        {
            "name": "CUB domain-containing protein",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "A0A494C103"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Homo sapiens",
            "taxid": 9606,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A494C103",
                    "url": "https://www.uniprot.org/uniprot/A0A494C103"
                }
            ],
            "common_name": "Human"
        }
    ],
    "gene": [
        {
            "name": "SPADH",
            "url": "https://www.uniprot.org/uniprot/A0A494C103",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "ENSG00000286135",
            "url": "https://bgee.org/?page=gene&gene_id=ENSG00000286135",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "cd00041",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00041",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "SPADH",
            "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SPADH",
            "database": "GeneCards",
            "categories": [
                "Organism-specific",
                "Gene Annotation"
            ]
        },
        {
            "id": "55808",
            "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=55808",
            "database": "HGNC",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "IPR000859",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000859",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR035914",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR035914",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "CGGHYTD",
            "url": "https://omabrowser.org/oma/group/CGGHYTD/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "4668456at2759",
            "url": "http://www.orthodb.org/?query=4668456at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00431",
            "url": "http://pfam.xfam.org/family/PF00431",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "A0A494C103",
            "url": "https://www.uniprot.org/uniprot/A0A494C103",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A494C103-1",
            "url": "https://www.uniprot.org/uniprot/A0A494C103-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MRLSRAFAWPLLCSIATTVKAPFATAPSDCGGHYTDEYGRIFNYAGPKTECVWIIELNPGEIVTVAIPDLKGFACGKEYVEVLDGPPGSESLDRICKAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDAWSTH",
        "length": 137,
        "header": "sp|A0A494C103-1|SPADH_HUMAN Isoform 1 of CUB domain-containing protein  OS=Homo sapiens OX=9606 GN=SPADH PE=3 SV=1 CANONICAL=A0A494C103-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A494C103-1",
            "url": "",
            "sequence": {
                "sequence": "MRLSRAFAWPLLCSIATTVKAPFATAPSDCGGHYTDEYGRIFNYAGPKTECVWIIELNPGEIVTVAIPDLKGFACGKEYVEVLDGPPGSESLDRICKAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDAWSTH",
                "length": 137,
                "header": "sp|A0A494C103-1|SPADH_HUMAN Isoform 1 of CUB domain-containing protein  OS=Homo sapiens OX=9606 GN=SPADH PE=3 SV=1 CANONICAL=A0A494C103-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [],
    "pathway": [],
    "orthologs": [],
    "go_annotation": {},
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        }
    ]
}