{ "uniprot_canonical_ac": "A0A3B3IU63-1", "uniprot_ac": "A0A3B3IU63", "uniprot_id": "H2AL3_HUMAN", "mass": { "chemical_mass": 17661.0, "monoisotopic_mass": 17661.0 }, "refseq": {}, "gene_names": [ { "name": "H2AL3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A3B3IU63", "id": "A0A3B3IU63" }, { "name": "H2AL1RP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A3B3IU63", "id": "A0A3B3IU63" } ], "protein_names": [ { "name": "Histone H2A-like 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A3B3IU63" }, { "name": "H2A.L.3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A3B3IU63" } ], "function": [ { "annotation": "Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.", "evidence": [ { "database": "UniProtKB", "id": "A0A3B3IU63", "url": "https://www.uniprot.org/uniprot/A0A3B3IU63#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A3B3IU63", "url": "https://www.uniprot.org/uniprot/A0A3B3IU63" } ], "common_name": "Human" } ], "gene": [ { "name": "H2AL3", "url": "https://www.uniprot.org/uniprot/A0A3B3IU63", "locus": { "chromosome": "X", "start_pos": 37994904, "end_pos": 37994272, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000229674", "url": "https://www.ensembl.org/id/ENSG00000229674" } ] } } ], "crossref": [ { "id": "ENSG00000229674", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000229674", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "H2AL3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=H2AL3", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "53960", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=53960", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR002119", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002119", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "HHKMRIT", "url": "https://omabrowser.org/oma/group/HHKMRIT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5211369at2759", "url": "http://www.orthodb.org/?query=5211369at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23430", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23430", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23430:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23430:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A3B3IU63", "url": "http://purl.obolibrary.org/obo/PR_A0A3B3IU63", "database": "PRO", "categories": [ "Protein" ] }, { "id": "A0A3B3IU63", "url": "https://www.uniprot.org/uniprot/A0A3B3IU63", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3IU63-1", "url": "https://www.uniprot.org/uniprot/A0A3B3IU63-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGNKMFCRPRRQRLSHSRRAELQFPVSHLERCLRESQHARHLSSTTPVFLAGVLEYLTANILEKVGKEVKNSCRLCITPEHVKRALQKDEQLRWILELEDDTHSQVEEMPQSEEEEEEEEEKEEEMVVLVVMGGRRRRRRRRRRKDS", "length": 148, "header": "sp|A0A3B3IU63-1|H2AL3_HUMAN Isoform 1 of Histone H2A-like 3 OS=Homo sapiens OX=9606 GN=H2AL3 PE=3 SV=1 CANONICAL=A0A3B3IU63-1" }, "isoforms": [ { "isoform_ac": "A0A3B3IU63-1", "url": "", "sequence": { "sequence": "MAGNKMFCRPRRQRLSHSRRAELQFPVSHLERCLRESQHARHLSSTTPVFLAGVLEYLTANILEKVGKEVKNSCRLCITPEHVKRALQKDEQLRWILELEDDTHSQVEEMPQSEEEEEEEEEKEEEMVVLVVMGGRRRRRRRRRRKDS", "length": 148, "header": "sp|A0A3B3IU63-1|H2AL3_HUMAN Isoform 1 of Histone H2A-like 3 OS=Homo sapiens OX=9606 GN=H2AL3 PE=3 SV=1 CANONICAL=A0A3B3IU63-1" }, "locus": { "chromosome": "X", "start_pos": 37994787, "end_pos": 37994344, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000448797.3", "url": "https://www.ensembl.org/id/ENST00000448797.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000498087.1", "url": "https://www.ensembl.org/id/ENSP00000498087.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A0A3B3IU63", "url": "https://www.uniprot.org/uniprot/A0A3B3IU63" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "A0A3B3IU63", "url": "https://www.uniprot.org/uniprot/A0A3B3IU63" } ], "pmid": "" }, { "name": "structural constituent of chromatin", "id": "GO:0030527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030527", "evidence": [ { "database": "UniProtKB", "id": "A0A3B3IU63", "url": "https://www.uniprot.org/uniprot/A0A3B3IU63" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A3B3IU63", "url": "https://www.uniprot.org/uniprot/A0A3B3IU63" } ], "pmid": "" }, { "name": "nucleosome", "id": "GO:0000786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000786", "evidence": [ { "database": "UniProtKB", "id": "A0A3B3IU63", "url": "https://www.uniprot.org/uniprot/A0A3B3IU63" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }