{ "uniprot_canonical_ac": "A0A3B2WD42-1", "uniprot_ac": "A0A3B2WD42", "uniprot_id": "A0A3B2WD42_MOUSE", "mass": { "chemical_mass": 7229.0, "monoisotopic_mass": 7229.0 }, "refseq": {}, "gene_names": [ { "name": "Gng5c", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A3B2WD42", "id": "A0A3B2WD42" }, { "name": "Gm4356", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A3B2WD42", "id": "A0A3B2WD42" } ], "protein_names": [ { "name": "Guanine nucleotide-binding protein subunit gamma", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A3B2WD42" } ], "function": [ { "annotation": "Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.", "evidence": [ { "database": "UniProtKB", "id": "A0A3B2WD42", "url": "https://www.uniprot.org/uniprot/A0A3B2WD42#function" }, { "database": "UniProtKB", "id": "RU004973", "url": "https://www.uniprot.org/uniprot/RU004973#function" } ] } ], "disease": [ { "disease_id": "DOID:9970", "recommended_name": { "id": "DOID:9970", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9970", "name": "obesity", "description": "An overnutrition that is characterized by excess body fat, traditionally defined as an elevated ratio of weight to height (specifically 30 kilograms per meter squared), has_material_basis_in a multifactorial etiology related to excess nutrition intake, decreased caloric utilization, and genetic susceptibility, and possibly medications and certain disorders of metabolism, endocrine function, and mental illness." }, "synonyms": [ { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "inherited obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity (disease)", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "leanness, inherited, autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "monogenic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, association with, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, early-onset, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, late-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, mild, early-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, and type II diabetes, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MIM:601665", "resource": "MIM", "url": "https://www.omim.org/entry/601665", "name": "Obesity", "description": "Obesity" } ], "evidence": [ { "id": "9970", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9970" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A3B2WD42", "url": "https://www.uniprot.org/uniprot/A0A3B2WD42" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gng5c", "url": "https://www.uniprot.org/uniprot/A0A3B2WD42", "locus": { "chromosome": "17", "start_pos": 28945674, "end_pos": 28945057, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000117145", "url": "https://www.ensembl.org/id/ENSMUSG00000117145" } ] } } ], "crossref": [ { "id": "ENSMUSG00000117145", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000117145", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00068", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00068", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001770", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001770", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015898", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015898", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036284", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036284", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "3782541", "url": "http://www.informatics.jax.org/marker/MGI:3782541", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "NPFRPHR", "url": "https://omabrowser.org/oma/group/NPFRPHR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR13809", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13809", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13809:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13809:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00631", "url": "http://pfam.xfam.org/family/PF00631", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A3B2WD42", "url": "https://www.uniprot.org/uniprot/A0A3B2WD42", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B2WD42-1", "url": "https://www.uniprot.org/uniprot/A0A3B2WD42-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLGSSSVAAMKKVVQQLRLEAGLNRVKVSLAAAGLKQFCLQNAQHDPLLTGGSSSTNPFRPQKVCSFL", "length": 68, "header": "tr|A0A3B2WD42-1|A0A3B2WD42_MOUSE Isoform 1 of Guanine nucleotide-binding protein subunit gamma OS=Mus musculus OX=10090 GN=Gng5c PE=3 SV=1 CANONICAL=A0A3B2WD42-1" }, "isoforms": [ { "isoform_ac": "A0A3B2WD42-1", "url": "", "sequence": { "sequence": "MLGSSSVAAMKKVVQQLRLEAGLNRVKVSLAAAGLKQFCLQNAQHDPLLTGGSSSTNPFRPQKVCSFL", "length": 68, "header": "tr|A0A3B2WD42-1|A0A3B2WD42_MOUSE Isoform 1 of Guanine nucleotide-binding protein subunit gamma OS=Mus musculus OX=10090 GN=Gng5c PE=3 SV=1 CANONICAL=A0A3B2WD42-1" }, "locus": { "chromosome": "17", "start_pos": 28945451, "end_pos": 28945248, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000233003.2", "url": "https://www.ensembl.org/id/ENSMUST00000233003.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000156831.2", "url": "https://www.ensembl.org/id/ENSMUSP00000156831.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "G-protein beta-subunit binding", "id": "GO:0031681", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031681", "evidence": [ { "database": "UniProtKB", "id": "A0A3B2WD42", "url": "https://www.uniprot.org/uniprot/A0A3B2WD42" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "A0A3B2WD42", "url": "https://www.uniprot.org/uniprot/A0A3B2WD42" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "heterotrimeric G-protein complex", "id": "GO:0005834", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005834", "evidence": [ { "database": "UniProtKB", "id": "A0A3B2WD42", "url": "https://www.uniprot.org/uniprot/A0A3B2WD42" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }