{ "uniprot_canonical_ac": "A0A3B2WD20-1", "uniprot_ac": "A0A3B2WD20", "uniprot_id": "A0A3B2WD20_MOUSE", "mass": { "chemical_mass": 17353.0, "monoisotopic_mass": 17353.0 }, "refseq": { "ac": "NP_001171000", "name": "exocrine gland-secreting peptide 6 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171000" }, "gene_names": [ { "name": "Esp6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A3B2WD20", "id": "A0A3B2WD20" }, { "name": "EG433107; Esp5; Gm5494", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171000", "id": "NP_001171000" }, { "name": "Esp6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171000", "id": "NP_001171000" } ], "protein_names": [ { "name": "Exocrine gland secreted peptide 6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A3B2WD20" }, { "name": "exocrine gland-secreting peptide 6 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171000", "id": "NP_001171000" }, { "name": "exocrine gland-secreting peptide 6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171000", "id": "NP_001171000" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A3B2WD20", "url": "https://www.uniprot.org/uniprot/A0A3B2WD20" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Esp6", "url": "https://www.uniprot.org/uniprot/A0A3B2WD20", "locus": { "chromosome": "17", "start_pos": 40876518, "end_pos": 40872398, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000092043", "url": "https://www.ensembl.org/id/ENSMUSG00000092043" } ] } } ], "crossref": [ { "id": "ENSMUSG00000092043", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000092043", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd14249", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14249", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "433107", "url": "https://www.ncbi.nlm.nih.gov/gene/433107", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR032253", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032253", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043126", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043126", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:433107", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:433107", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3643294", "url": "http://www.informatics.jax.org/marker/MGI:3643294", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "4850388at2759", "url": "http://www.orthodb.org/?query=4850388at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PF16590", "url": "http://pfam.xfam.org/family/PF16590", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A8R0U0", "url": "http://purl.obolibrary.org/obo/PR_A8R0U0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "A0A3B2WD20", "url": "https://www.uniprot.org/uniprot/A0A3B2WD20", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B2WD20-1", "url": "https://www.uniprot.org/uniprot/A0A3B2WD20-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8R0U0", "url": "https://www.uniprot.org/uniprot/A8R0U0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8R0U0-1", "url": "https://www.uniprot.org/uniprot/A8R0U0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEEAIPAKTKDYESNFHVSVMTSLPMMIFLVILLLPSMPTEGRVLTQTQEQSTISADQKTNQETFLDKIESKGNPGNPSIKEAIEMFSCAFDQDKTLLEDQSNSDQPSLNLSKLMTTLNKCGAQKYKVAEYVPEDGLAGHEWPEGSLVLRLLDNPV", "length": 156, "header": "tr|A0A3B2WD20-1|A0A3B2WD20_MOUSE Isoform 1 of Exocrine gland secreted peptide 6 OS=Mus musculus OX=10090 GN=Esp6 PE=4 SV=1 CANONICAL=A0A3B2WD20-1" }, "isoforms": [ { "isoform_ac": "A0A3B2WD20-1", "url": "", "sequence": { "sequence": "MEEAIPAKTKDYESNFHVSVMTSLPMMIFLVILLLPSMPTEGRVLTQTQEQSTISADQKTNQETFLDKIESKGNPGNPSIKEAIEMFSCAFDQDKTLLEDQSNSDQPSLNLSKLMTTLNKCGAQKYKVAEYVPEDGLAGHEWPEGSLVLRLLDNPV", "length": 156, "header": "tr|A0A3B2WD20-1|A0A3B2WD20_MOUSE Isoform 1 of Exocrine gland secreted peptide 6 OS=Mus musculus OX=10090 GN=Esp6 PE=4 SV=1 CANONICAL=A0A3B2WD20-1" }, "locus": { "chromosome": "17", "start_pos": 40876361, "end_pos": 40872436, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000232937.2", "url": "https://www.ensembl.org/id/ENSMUST00000232937.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000156808.2", "url": "https://www.ensembl.org/id/ENSMUSP00000156808.2" } ] } }, { "isoform_ac": "A8R0U0-1", "url": "", "sequence": { "sequence": "MTSLPMMIFLVILLLPSMPTEGRVLTQTQEQSTISADQKTNQETFLDKIESKGNPGNPSIKEAIEMFSCAFDQDKTLLEDQSNSDQPSLNLSKLMTTLNKCGAQKYKVAEYVPEDGLAGHEWPEGSLVLRLLDNPV", "length": 136, "header": "tr|A8R0U0-1|A8R0U0_MOUSE Computationally mapped isoform of Exocrine gland-secreting peptide 6 OS=Mus musculus OX=10090 GN=Esp6 PE=2 SV=1 CANONICAL=A0A3B2WD20-1" }, "locus": { "chromosome": "17", "start_pos": 40876361, "end_pos": 40873815, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000097324.4", "url": "https://www.ensembl.org/id/ENSMUST00000097324.4" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000094930.4", "url": "https://www.ensembl.org/id/ENSMUSP00000094930.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "mmu:433107", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:433107", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0A3B2WD20", "url": "https://www.uniprot.org/uniprot/A0A3B2WD20" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A3B2WD20", "url": "https://www.uniprot.org/uniprot/A0A3B2WD20" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "pheromone activity", "id": "GO:0005186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005186", "evidence": [ { "database": "UniProtKB", "id": "A0A3B2WD20", "url": "https://www.uniprot.org/uniprot/A0A3B2WD20" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 110, "end_pos": 112, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }