{ "uniprot_canonical_ac": "A0A3B0IP42-1", "uniprot_ac": "A0A3B0IP42", "uniprot_id": "A0A3B0IP42_RAT", "mass": { "chemical_mass": 29292.0, "monoisotopic_mass": 29292.0 }, "refseq": { "ac": "NP_001099419", "name": "complement C1q-like protein 2 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099419" }, "gene_names": [ { "name": "C1ql2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42", "id": "A0A3B0IP42" }, { "name": "Adii", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099419", "id": "NP_001099419" }, { "name": "C1ql2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099419", "id": "NP_001099419" } ], "protein_names": [ { "name": "Complement C1q like 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A3B0IP42" }, { "name": "complement C1q-like protein 2 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099419", "id": "NP_001099419" }, { "name": "complement C1q-like protein 2; complement component 1, q subcomponent-like 2; adiponectin i", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099419", "id": "NP_001099419" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A3B0IP42", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42" } ], "common_name": "Rat" } ], "gene": [ { "name": "C1ql2", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42", "locus": { "chromosome": "13", "start_pos": 31472689, "end_pos": 31471150, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000046863", "url": "https://www.ensembl.org/id/ENSRNOG00000046863" } ] } } ], "crossref": [ { "id": "ENSRNOG00000046863", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000046863", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "288979", "url": "https://www.ncbi.nlm.nih.gov/gene/288979", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001073", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001073", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008983", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008983", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:288979", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:288979", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GHYEMMG", "url": "https://omabrowser.org/oma/group/GHYEMMG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4210331at2759", "url": "http://www.orthodb.org/?query=4210331at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22923", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22923", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22923:SF69", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22923:SF69", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00386", "url": "http://pfam.xfam.org/family/PF00386", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001099419", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001099419", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1594583", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1594583", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A3B0IP42", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B0IP42-1", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALGLLIAVPLLLQAAPPGAAHYEMLGTCRMICDPYTVSPAGGPAGAKAPPPGPSTAALEVMQDLSANPPPPFIQGPKGDPGRPGKPGPRGPPGEPGPPGPRGPPGEKGDSGRPGLPGLQLTTSAAGGVGVVGGGTGGGGDTEGEVTSALSAAFSGPKIAFYVGLKSPHEGYEVLKFDDVVTNLGNHYDPTTGKFSCQVRGIYFFTYHILMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVVLHLDSGDEVYVKLDGGKAHGGNNNKYSTFSGFLLYPD", "length": 287, "header": "tr|A0A3B0IP42-1|A0A3B0IP42_RAT Isoform 1 of Complement C1q like 2 OS=Rattus norvegicus OX=10116 GN=C1ql2 PE=4 SV=1 CANONICAL=A0A3B0IP42-1" }, "isoforms": [ { "isoform_ac": "A0A3B0IP42-1", "url": "", "sequence": { "sequence": "MALGLLIAVPLLLQAAPPGAAHYEMLGTCRMICDPYTVSPAGGPAGAKAPPPGPSTAALEVMQDLSANPPPPFIQGPKGDPGRPGKPGPRGPPGEPGPPGPRGPPGEKGDSGRPGLPGLQLTTSAAGGVGVVGGGTGGGGDTEGEVTSALSAAFSGPKIAFYVGLKSPHEGYEVLKFDDVVTNLGNHYDPTTGKFSCQVRGIYFFTYHILMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVVLHLDSGDEVYVKLDGGKAHGGNNNKYSTFSGFLLYPD", "length": 287, "header": "tr|A0A3B0IP42-1|A0A3B0IP42_RAT Isoform 1 of Complement C1q like 2 OS=Rattus norvegicus OX=10116 GN=C1ql2 PE=4 SV=1 CANONICAL=A0A3B0IP42-1" }, "locus": { "chromosome": "13", "start_pos": 31472682, "end_pos": 31471239, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000071305.3", "url": "https://www.ensembl.org/id/ENSRNOT00000071305.3" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000066827.3", "url": "https://www.ensembl.org/id/ENSRNOP00000066827.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:288979", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:288979", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q7Z5L3-1", "protein_name": "Complement C1q-like protein 2", "gene_name": "C1QL2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALGLLIAVPLLLQAAPRGAAHYEMMGTCRMICDPYTAAPGGEPPGAKAQPPGPSTAALEVMQDLSANPPPPFIQGPKGDPGRPGKPGPRGPPGEPGPPGPRGPPGEKGDSGRPGLPGLQLTAGTASGVGVVGGGAGVGGDSEGEVTSALSATFSGPKIAFYVGLKSPHEGYEVLKFDDVVTNLGNHYDPTTGKFSCQVRGIYFFTYHILMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVVLHLDSGDEVYVKLDGGKAHGGNNNKYSTFSGFLLYPD", "length": 287 }, "evidence": [ { "id": "45235438", "url": "http://www.informatics.jax.org/homology/45235438", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8CFR0-1", "protein_name": "Complement C1q-like protein 2", "gene_name": "C1ql2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MALGLLIAVPLLLQAAPPGAAHYEMLGTCRMICDPYSVAPAGGPAGAKAPPPGPSTAALEVMQDLSANPPPPFIQGPKGDPGRPGKPGPRGPPGEPGPPGPRGPPGEKGDSGRPGLPGLQLTTSAAGGVGVVSGGTGGGGDTEGEVTSALSAAFSGPKIAFYVGLKSPHEGYEVLKFDDVVTNLGNHYDPTTGKFSCQVRGIYFFTYHILMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVVLHLDSGDEVYVKLDGGKAHGGNNNKYSTFSGFLLYPD", "length": 287 }, "evidence": [ { "id": "45235438", "url": "http://www.informatics.jax.org/homology/45235438", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "postsynaptic density assembly", "id": "GO:0097107", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097107", "evidence": [ { "database": "UniProtKB", "id": "A0A3B0IP42", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42" } ], "pmid": "" }, { "name": "regulation of synapse maturation", "id": "GO:0090128", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090128", "evidence": [ { "database": "UniProtKB", "id": "A0A3B0IP42", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42" } ], "pmid": "" }, { "name": "neurotransmitter receptor localization to postsynaptic specialization membrane", "id": "GO:0099645", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099645", "evidence": [ { "database": "UniProtKB", "id": "A0A3B0IP42", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "glutamatergic synapse", "id": "GO:0098978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098978", "evidence": [ { "database": "UniProtKB", "id": "A0A3B0IP42", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A0A3B0IP42", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42" } ], "pmid": "" }, { "name": "synaptic cleft", "id": "GO:0043083", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043083", "evidence": [ { "database": "UniProtKB", "id": "A0A3B0IP42", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "A0A3B0IP42", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42" } ], "pmid": "" }, { "name": "hippocampal mossy fiber to CA3 synapse", "id": "GO:0098686", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098686", "evidence": [ { "database": "UniProtKB", "id": "A0A3B0IP42", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42" } ], "pmid": "" }, { "name": "cerebellar climbing fiber to Purkinje cell synapse", "id": "GO:0150053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150053", "evidence": [ { "database": "UniProtKB", "id": "A0A3B0IP42", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "A0A3B0IP42", "url": "https://www.uniprot.org/uniprot/A0A3B0IP42" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }