{ "uniprot_canonical_ac": "A0A1Y7VLT7-1", "uniprot_ac": "A0A1Y7VLT7", "uniprot_id": "A0A1Y7VLT7_MOUSE", "mass": { "chemical_mass": 16630.0, "monoisotopic_mass": 16630.0 }, "refseq": { "ac": "NP_001171045", "name": "Eif1a-like", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171045" }, "gene_names": [ { "name": "Eif1ad4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1Y7VLT7", "id": "A0A1Y7VLT7" }, { "name": "100039052; Gm2022", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171045", "id": "NP_001171045" }, { "name": "Eif1ad4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171045", "id": "NP_001171045" } ], "protein_names": [ { "name": "Eukaryotic translation initiation factor 4C", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A1Y7VLT7" }, { "name": "Eif1a-like", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171045", "id": "NP_001171045" }, { "name": "predicted pseudogene 2022", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171045", "id": "NP_001171045" } ], "function": [ { "annotation": "Component of the 43S pre-initiation complex (43S PIC), which binds to the mRNA cap-proximal region, scans mRNA 5'-untranslated region, and locates the initiation codon. This protein enhances formation of the cap-proximal complex. Together with EIF1, facilitates scanning, start codon recognition, promotion of the assembly of 48S complex at the initiation codon (43S PIC becomes 48S PIC after the start codon is reached), and dissociation of aberrant complexes. After start codon location, together with EIF5B orients the initiator methionine-tRNA in a conformation that allows 60S ribosomal subunit joining to form the 80S initiation complex. Is released after 80S initiation complex formation, just after GTP hydrolysis by EIF5B, and before release of EIF5B. Its globular part is located in the A site of the 40S ribosomal subunit. Its interaction with EIF5 during scanning contribute to the maintenance of EIF1 within the open 43S PIC. In contrast to yeast orthologs, does not bind EIF1.", "evidence": [ { "database": "UniProtKB", "id": "A0A1Y7VLT7", "url": "https://www.uniprot.org/uniprot/A0A1Y7VLT7#function" }, { "database": "UniProtKB", "id": "RU004365", "url": "https://www.uniprot.org/uniprot/RU004365#function" } ] } ], "disease": [ { "disease_id": "DOID:6039", "recommended_name": { "id": "DOID:6039", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6039", "name": "uveal melanoma", "description": "A uveal cancer that has_material_basis_in uvea pigment cells." }, "synonyms": [ { "id": "DOID:6039", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:6039", "name": "melanoma of Uvea", "description": "" }, { "id": "MONDO:0006486", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006486", "name": "uveal melanoma", "description": "A melanoma derived from melanocytes of the uveal tract. It is the most common primary intraocular tumor in the United States and Western Europe. Similar to melanoma of the skin, it is rare in Africa and Asia. Diagnostic procedures include ophthalmoscopic exam, fluorescein angiography and ultrasound. Treatment includes: surgical excision of the eye, iridocyclectomy and tumor resection. Recent treatments also include radiotherapy or photo coagulation. Classification of uveal melanomas recognizes four cell types within these tumors: epithelioid, intermediate, mixed cell, and spindle cell types. The spindle cell type uveal melanomas are further sub-classified as spindle cell type A and spindle cell type B." }, { "id": "MONDO:0006486", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006486", "name": "intraocular melanoma", "description": "" }, { "id": "MONDO:0006486", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006486", "name": "melanoma (disease) of uvea", "description": "" }, { "id": "MONDO:0006486", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006486", "name": "melanoma of the uvea", "description": "" }, { "id": "MONDO:0006486", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006486", "name": "melanoma of uvea", "description": "" }, { "id": "MONDO:0006486", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006486", "name": "melanoma, uveal, malignant", "description": "" }, { "id": "MONDO:0006486", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006486", "name": "uvea melanoma", "description": "" }, { "id": "MONDO:0006486", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006486", "name": "uvea melanoma (disease)", "description": "" }, { "id": "MONDO:0006486", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006486", "name": "uveal melanoma", "description": "" }, { "id": "MONDO:0006486", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006486", "name": "iris melanoma", "description": "" }, { "id": "MONDO:0006486", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0006486", "name": "choroidal melanoma", "description": "" }, { "id": "MONDO:0011695", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011695", "name": "melanoma, uveal, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011695", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011695", "name": "UVM1", "description": "" }, { "id": "MONDO:0011695", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011695", "name": "melanoma, uveal, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011695", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011695", "name": "melanoma, uveal, susceptibility to, type 1", "description": "" }, { "id": "MONDO:0011696", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011696", "name": "melanoma, uveal, susceptibility to, 2", "description": "" }, { "id": "MONDO:0011696", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011696", "name": "UVM2", "description": "" }, { "id": "MONDO:0011696", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011696", "name": "melanoma, uveal, susceptibility to, 2", "description": "" }, { "id": "MONDO:0011696", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011696", "name": "melanoma, uveal, susceptibility to, type 2", "description": "" }, { "id": "MIM:606660", "resource": "MIM", "url": "https://www.omim.org/entry/606660", "name": "Melanoma, uveal, 1", "description": "Melanoma, uveal, 1" }, { "id": "MIM:606661", "resource": "MIM", "url": "https://www.omim.org/entry/606661", "name": "Melanoma, uveal, 2", "description": "Melanoma, uveal, 2" } ], "evidence": [ { "id": "6039", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:6039" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A1Y7VLT7", "url": "https://www.uniprot.org/uniprot/A0A1Y7VLT7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Eif1ad4", "url": "https://www.uniprot.org/uniprot/A0A1Y7VLT7", "locus": { "chromosome": "12", "start_pos": 87863503, "end_pos": 87859578, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000113971", "url": "https://www.ensembl.org/id/ENSMUSG00000113971" } ] } } ], "crossref": [ { "id": "ENSMUSG00000113971", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000113971", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05793", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05793", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100039052", "url": "https://www.ncbi.nlm.nih.gov/gene/100039052", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001253", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001253", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006196", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006196", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012340", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012340", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018104", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018104", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:100039052", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:100039052", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3780191", "url": "http://www.informatics.jax.org/marker/MGI:3780191", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "2919581at2759", "url": "http://www.orthodb.org/?query=2919581at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21668", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21668", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21668:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21668:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01176", "url": "http://pfam.xfam.org/family/PF01176", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001171045", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001171045", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1Y7VLT7", "url": "https://www.uniprot.org/uniprot/A0A1Y7VLT7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1Y7VLT7-1", "url": "https://www.uniprot.org/uniprot/A0A1Y7VLT7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPKNKGKGGKNRRRGKNENESEKRELVFKEYGQEYAQVTKMLGCGWLEAMCFDGVRRLCHIRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNQDEARSLKAYGELPEHAKINEMDTFGPGDDDEIVFDDIGEDDEDIDDI", "length": 144, "header": "tr|A0A1Y7VLT7-1|A0A1Y7VLT7_MOUSE Isoform 1 of Eukaryotic translation initiation factor 4C OS=Mus musculus OX=10090 GN=Eif1ad4 PE=3 SV=1 CANONICAL=A0A1Y7VLT7-1" }, "isoforms": [ { "isoform_ac": "A0A1Y7VLT7-1", "url": "", "sequence": { "sequence": "MPKNKGKGGKNRRRGKNENESEKRELVFKEYGQEYAQVTKMLGCGWLEAMCFDGVRRLCHIRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNQDEARSLKAYGELPEHAKINEMDTFGPGDDDEIVFDDIGEDDEDIDDI", "length": 144, "header": "tr|A0A1Y7VLT7-1|A0A1Y7VLT7_MOUSE Isoform 1 of Eukaryotic translation initiation factor 4C OS=Mus musculus OX=10090 GN=Eif1ad4 PE=3 SV=1 CANONICAL=A0A1Y7VLT7-1" }, "locus": { "chromosome": "12", "start_pos": 87862571, "end_pos": 87862140, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000220585.3", "url": "https://www.ensembl.org/id/ENSMUST00000220585.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000152354.2", "url": "https://www.ensembl.org/id/ENSMUSP00000152354.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "mmu:100039052", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:100039052", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "A0A1Y7VLT7", "url": "https://www.uniprot.org/uniprot/A0A1Y7VLT7" } ], "pmid": "" }, { "name": "translation initiation factor activity", "id": "GO:0003743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003743", "evidence": [ { "database": "UniProtKB", "id": "A0A1Y7VLT7", "url": "https://www.uniprot.org/uniprot/A0A1Y7VLT7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A1Y7VLT7", "url": "https://www.uniprot.org/uniprot/A0A1Y7VLT7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "translational initiation", "id": "GO:0006413", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006413", "evidence": [ { "database": "UniProtKB", "id": "A0A1Y7VLT7", "url": "https://www.uniprot.org/uniprot/A0A1Y7VLT7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 19, "end_pos": 21, "annotation": "n_glycosylation_sequon" }, { "start_pos": 72, "end_pos": 74, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }