{ "uniprot_canonical_ac": "A0A1W2PRP0-1", "uniprot_ac": "A0A1W2PRP0", "uniprot_id": "FOXL3_HUMAN", "mass": { "chemical_mass": 25969.0, "monoisotopic_mass": 25969.0 }, "refseq": {}, "gene_names": [ { "name": "FOXL3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1W2PRP0", "id": "A0A1W2PRP0" } ], "protein_names": [ { "name": "Forkhead box protein L3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A1W2PRP0" } ], "function": [ { "annotation": "Probable transcriptional regulator.", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PRP0", "url": "https://www.uniprot.org/uniprot/A0A1W2PRP0#function" }, { "database": "UniProtKB", "id": "Q12952", "url": "https://www.uniprot.org/uniprot/Q12952#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PRP0", "url": "https://www.uniprot.org/uniprot/A0A1W2PRP0" } ], "common_name": "Human" } ], "gene": [ { "name": "FOXL3", "url": "https://www.uniprot.org/uniprot/A0A1W2PRP0", "locus": { "chromosome": "7", "start_pos": 294422, "end_pos": 290170, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000248767", "url": "https://www.ensembl.org/id/ENSG00000248767" } ] } } ], "crossref": [ { "id": "ENSG00000248767", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000248767", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FOXL3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FOXL3", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "54201", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=54201", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR001766", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001766", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030456", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030456", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036390", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "NX_A0A1W2PRP0", "url": "https://www.nextprot.org/entry/NX_A0A1W2PRP0", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "YNCFNDD", "url": "https://omabrowser.org/oma/group/YNCFNDD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5385885at2759", "url": "http://www.orthodb.org/?query=5385885at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11829", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11829", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11829:SF211", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11829:SF211", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00250", "url": "http://pfam.xfam.org/family/PF00250", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A1W2PRP0", "url": "http://purl.obolibrary.org/obo/PR_A0A1W2PRP0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_011513358", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_011513358", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1W2PRP0", "url": "https://www.uniprot.org/uniprot/A0A1W2PRP0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRP0-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PRP0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRW6", "url": "https://www.uniprot.org/uniprot/A0A1W2PRW6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRW6-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PRW6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFDSSQYPYNCFNYDADDYPAGSSDEDKRLTRPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYRANQRAWQNSIRHNLSLNSCFVKVPRSEGHEKGKGNYWTFAGGCESLLDLFENGNYRRRRRRRGPKREGPRGPRAGGAQGPSGPSEPPAAQGRLAPDSAGEGAPGREPPASPAPPGKEHPRDLKFSIDYILSSPDPFPGLKPPCLAQEGRYPRLENVGLHFWTM", "length": 233, "header": "sp|A0A1W2PRP0-1|FOXL3_HUMAN Isoform 1 of Forkhead box protein L3 OS=Homo sapiens OX=9606 GN=FOXL3 PE=3 SV=1 CANONICAL=A0A1W2PRP0-1" }, "isoforms": [ { "isoform_ac": "A0A1W2PRP0-1", "url": "", "sequence": { "sequence": "MFDSSQYPYNCFNYDADDYPAGSSDEDKRLTRPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYRANQRAWQNSIRHNLSLNSCFVKVPRSEGHEKGKGNYWTFAGGCESLLDLFENGNYRRRRRRRGPKREGPRGPRAGGAQGPSGPSEPPAAQGRLAPDSAGEGAPGREPPASPAPPGKEHPRDLKFSIDYILSSPDPFPGLKPPCLAQEGRYPRLENVGLHFWTM", "length": 233, "header": "sp|A0A1W2PRP0-1|FOXL3_HUMAN Isoform 1 of Forkhead box protein L3 OS=Homo sapiens OX=9606 GN=FOXL3 PE=3 SV=1 CANONICAL=A0A1W2PRP0-1" }, "locus": { "chromosome": "7", "start_pos": 291485, "end_pos": 290170, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000506382.2", "url": "https://www.ensembl.org/id/ENST00000506382.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000492766.1", "url": "https://www.ensembl.org/id/ENSP00000492766.1" } ] } }, { "isoform_ac": "A0A1W2PRW6-1", "url": "", "sequence": { "sequence": "XEHPRDLKFSIDYILSSPDPFPGLKPPCLAQEGRYPRLENVGLHFWTM", "length": 48, "header": "tr|A0A1W2PRW6-1|A0A1W2PRW6_HUMAN Computationally mapped isoform of Forkhead box L3 OS=Homo sapiens OX=9606 GN=FOXL3 PE=4 SV=1 CANONICAL=A0A1W2PRP0-1" }, "locus": { "chromosome": "7", "start_pos": 291487, "end_pos": 291344, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000510017.1", "url": "https://www.ensembl.org/id/ENST00000510017.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492517.1", "url": "https://www.ensembl.org/id/ENSP00000492517.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PRP0", "url": "https://www.uniprot.org/uniprot/A0A1W2PRP0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PRP0", "url": "https://www.uniprot.org/uniprot/A0A1W2PRP0" } ], "pmid": "" }, { "name": "cell differentiation", "id": "GO:0030154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PRP0", "url": "https://www.uniprot.org/uniprot/A0A1W2PRP0" } ], "pmid": "" }, { "name": "anatomical structure morphogenesis", "id": "GO:0009653", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009653", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PRP0", "url": "https://www.uniprot.org/uniprot/A0A1W2PRP0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PRP0", "url": "https://www.uniprot.org/uniprot/A0A1W2PRP0" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PRP0", "url": "https://www.uniprot.org/uniprot/A0A1W2PRP0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 83, "end_pos": 85, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }