{
    "uniprot_canonical_ac": "A0A1L1SSZ5-1",
    "uniprot_ac": "A0A1L1SSZ5",
    "uniprot_id": "A0A1L1SSZ5_MOUSE",
    "mass": {
        "chemical_mass": 34282.0,
        "monoisotopic_mass": 34282.0
    },
    "refseq": {
        "ac": "NP_667002",
        "name": "olfactory receptor 1248",
        "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667002"
    },
    "gene_names": [
        {
            "name": "Or4a75",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A0A1L1SSZ5",
            "id": "A0A1L1SSZ5"
        },
        {
            "name": "MOR23110; Olfr1248",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667002",
            "id": "NP_667002"
        },
        {
            "name": "Olfr1248",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A1L1SSZ5",
            "id": "A0A1L1SSZ5"
        },
        {
            "name": "Or4a75",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667002",
            "id": "NP_667002"
        }
    ],
    "protein_names": [
        {
            "name": "Olfactory receptor family 4 subfamily A member 75",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "A0A1L1SSZ5"
        },
        {
            "name": "olfactory receptor 1248",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667002",
            "id": "NP_667002"
        }
    ],
    "function": [
        {
            "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_667002",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667002"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A1L1SSZ5",
                    "url": "https://www.uniprot.org/uniprot/A0A1L1SSZ5"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Or4a75",
            "url": "https://www.uniprot.org/uniprot/A0A1L1SSZ5",
            "locus": {
                "chromosome": "2",
                "start_pos": 89447512,
                "end_pos": 89448589,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000111239",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000111239"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "cd15939",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15939",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "258787",
            "url": "https://www.ncbi.nlm.nih.gov/gene/258787",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000276",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR000725",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017452",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:258787",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258787",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "3031082",
            "url": "http://www.informatics.jax.org/marker/MGI:3031082",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "LTVVARW",
            "url": "https://omabrowser.org/oma/group/LTVVARW/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "4052270at2759",
            "url": "http://www.orthodb.org/?query=4052270at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR48002",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48002",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR48002:SF147",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48002:SF147",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF13853",
            "url": "http://pfam.xfam.org/family/PF13853",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_667002",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667002",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1L1SSZ5",
            "url": "https://www.uniprot.org/uniprot/A0A1L1SSZ5",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A1L1SSZ5-1",
            "url": "https://www.uniprot.org/uniprot/A0A1L1SSZ5-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MGQNNNVTEFILLGLTQDPAGQKVLFVMFLLIYIVKIVGNLLIVGTVIASPSLGSPMYFFLAFLSLMDAVYSTAILPKLLTDLLCDKKTISFTACLVQLFVEHLFGGSEVFILVVMAYDHYVAICKPLHYLTIMKRQVCILLVVVSWAGGFAHALLQVISVYLLPFCGPNVIDHFACDIYPLLGLACTDTYFLGLTVVSSYGAMSIVAFILLLVSYGIILNSLKTDSQEGRRKALSTCSSHIMVVVLFFVPCIFMYVRPISNFPIDKYITVFYTIFTPMLNPLIYTLRNMEIKNCMAKLWSKMFTKA",
        "length": 307,
        "header": "tr|A0A1L1SSZ5-1|A0A1L1SSZ5_MOUSE Isoform 1 of Olfactory receptor family 4 subfamily A member 75  OS=Mus musculus OX=10090 GN=Or4a75 PE=4 SV=1 CANONICAL=A0A1L1SSZ5-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A1L1SSZ5-1",
            "url": "",
            "sequence": {
                "sequence": "MGQNNNVTEFILLGLTQDPAGQKVLFVMFLLIYIVKIVGNLLIVGTVIASPSLGSPMYFFLAFLSLMDAVYSTAILPKLLTDLLCDKKTISFTACLVQLFVEHLFGGSEVFILVVMAYDHYVAICKPLHYLTIMKRQVCILLVVVSWAGGFAHALLQVISVYLLPFCGPNVIDHFACDIYPLLGLACTDTYFLGLTVVSSYGAMSIVAFILLLVSYGIILNSLKTDSQEGRRKALSTCSSHIMVVVLFFVPCIFMYVRPISNFPIDKYITVFYTIFTPMLNPLIYTLRNMEIKNCMAKLWSKMFTKA",
                "length": 307,
                "header": "tr|A0A1L1SSZ5-1|A0A1L1SSZ5_MOUSE Isoform 1 of Olfactory receptor family 4 subfamily A member 75  OS=Mus musculus OX=10090 GN=Or4a75 PE=4 SV=1 CANONICAL=A0A1L1SSZ5-1"
            },
            "locus": {
                "chromosome": "2",
                "start_pos": 89448534,
                "end_pos": 89447614,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000216129.2",
                        "url": "https://www.ensembl.org/id/ENSMUST00000216129.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000150117.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000150117.2"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [],
    "pathway": [
        {
            "id": "mmu:258787",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258787",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "A0A8I6AUF8-1",
            "protein_name": "Olfactory receptor",
            "gene_name": "Or4a77b",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MEETNNVTEFILLGLTQDPAGQKVLFVMFLLIYIVTIGGNLLIVGTVIASPSLGSPMYFFLAFLSLMDAVYSTAILPKLLTDLLCDKKAISVKACLVQLFVEHLFGGSEVFILVVMAYDRYVAICKPLHYLTIMNRQVCILLLVVSWAGGFAHALLQVISVYLLPFCGPNVIDHFACDMYPLLGLACTDTYFLGLSVIGNNGAMSIVVFILLLVSYGIILNSLKTYSQEGRRKALSTCSSHIMVVILFFVPCIFMYVRPVSNFPIDKYITVFYTIFTPMLNPLIYTLRNMEIKNCMAKLWGKMFTKDIKKISAH",
                "length": 314
            },
            "evidence": [
                {
                    "id": "45242832",
                    "url": "http://www.informatics.jax.org/homology/45242832",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q8NH70-1",
            "protein_name": "Olfactory receptor 4A16",
            "gene_name": "OR4A16",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MRPSSNVTEFVLLGLTQDPDVKKTLFVMFLLIYIVTMVGNLLIWVTTIGSPSLGSLMYFFLAYLSLMDAIYSTAMSPKLMIDLLCDKIAISLSACMGQLFIEHLLGGAEVFLLVVMAYDRYVAISKPLHYLNIMNRLVCILLLVVAMIGGFVHSVVQIVFLYSLPICGPNVIDHSVCDMYPLLELLCLDTYFIGLTVVANGGIICMVIFTFLLISCGVILNFLKTYSQEERHKALPTCISHIIVVALVFVPCIFMYVRPVSNFPFDKLMTVFYSIITLMLNPLIYSLRQSEMKNAMKNLWCEKLSIVRKRVSPTLNIFIPSSKATNRR",
                "length": 328
            },
            "evidence": [
                {
                    "id": "45242832",
                    "url": "http://www.informatics.jax.org/homology/45242832",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor activity",
                        "id": "GO:0004930",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1L1SSZ5",
                                "url": "https://www.uniprot.org/uniprot/A0A1L1SSZ5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "olfactory receptor activity",
                        "id": "GO:0004984",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1L1SSZ5",
                                "url": "https://www.uniprot.org/uniprot/A0A1L1SSZ5"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A1L1SSZ5",
                                "url": "https://www.uniprot.org/uniprot/A0A1L1SSZ5"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 6,
            "end_pos": 8,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        }
    ]
}