{ "uniprot_canonical_ac": "A0A1D5RMB0-1", "uniprot_ac": "A0A1D5RMB0", "uniprot_id": "A0A1D5RMB0_MOUSE", "mass": { "chemical_mass": 41088.0, "monoisotopic_mass": 41088.0 }, "refseq": {}, "gene_names": [ { "name": "Adh6b", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0", "id": "A0A1D5RMB0" } ], "protein_names": [ { "name": "Alcohol dehydrogenase 6B (class V)", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A1D5RMB0" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A1D5RMB0", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Adh6b", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0", "locus": { "chromosome": "3", "start_pos": 138064622, "end_pos": 138047536, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000074206", "url": "https://www.ensembl.org/id/ENSMUSG00000074206" } ] } } ], "crossref": [ { "id": "ENSMUSG00000074206", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000074206", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR002328", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002328", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011032", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011032", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013149", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013149", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013154", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013154", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020843", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020843", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036291", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036291", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "2446626", "url": "http://www.informatics.jax.org/marker/MGI:2446626", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "VMHEISV", "url": "https://omabrowser.org/oma/group/VMHEISV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4636224at2759", "url": "http://www.orthodb.org/?query=4636224at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43880", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43880", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43880:SF51", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43880:SF51", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00107", "url": "http://pfam.xfam.org/family/PF00107", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08240", "url": "http://pfam.xfam.org/family/PF08240", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_006502620", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006502620", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1D5RMB0", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1D5RMB0-1", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3UQ40", "url": "https://www.uniprot.org/uniprot/Q3UQ40", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3UQ40-1", "url": "https://www.uniprot.org/uniprot/Q3UQ40-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEQASLATKTSSNVIRCRAAVAWTTNAPLSIEEVEVDPPKAGEVRVKIIASGICGTDNHTLEGKMKTPFPVILGHEGAGVVESVGPGVTTVKPGDKVLMFPLPECRECFYCLYPKGNFCEKENILSPTGLMLDGTSRFTCRGKKIYNIMGTSTFTEYTVVHEIAVAKIEAAAPMDTVCIMSCAVPTGFGAVFNTAQVTPGSSCVVFGLGGIGSAIVMACKASGACRIIGVDINEEKFPRARALGVTDCLNPNKLKKPVQEVVKEMTGVGVDFAFEAIGLIETMVAALKSCNRSYGVCVIMGVAPTGSQLSFDPLVLLPGRTLKSSVLGGYKTRDDIPKLVTDYVQKKINIDPLITHRLPFPKINEGFRLLQEGKCIRCVLSMRP", "length": 384, "header": "tr|A0A1D5RMB0-1|A0A1D5RMB0_MOUSE Isoform 1 of Alcohol dehydrogenase 6B (class V) OS=Mus musculus OX=10090 GN=Adh6b PE=1 SV=1 CANONICAL=A0A1D5RMB0-1" }, "isoforms": [ { "isoform_ac": "A0A1D5RMB0-1", "url": "", "sequence": { "sequence": "MEQASLATKTSSNVIRCRAAVAWTTNAPLSIEEVEVDPPKAGEVRVKIIASGICGTDNHTLEGKMKTPFPVILGHEGAGVVESVGPGVTTVKPGDKVLMFPLPECRECFYCLYPKGNFCEKENILSPTGLMLDGTSRFTCRGKKIYNIMGTSTFTEYTVVHEIAVAKIEAAAPMDTVCIMSCAVPTGFGAVFNTAQVTPGSSCVVFGLGGIGSAIVMACKASGACRIIGVDINEEKFPRARALGVTDCLNPNKLKKPVQEVVKEMTGVGVDFAFEAIGLIETMVAALKSCNRSYGVCVIMGVAPTGSQLSFDPLVLLPGRTLKSSVLGGYKTRDDIPKLVTDYVQKKINIDPLITHRLPFPKINEGFRLLQEGKCIRCVLSMRP", "length": 384, "header": "tr|A0A1D5RMB0-1|A0A1D5RMB0_MOUSE Isoform 1 of Alcohol dehydrogenase 6B (class V) OS=Mus musculus OX=10090 GN=Adh6b PE=1 SV=1 CANONICAL=A0A1D5RMB0-1" }, "locus": { "chromosome": "3", "start_pos": 138064462, "end_pos": 138048620, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000199673.6", "url": "https://www.ensembl.org/id/ENSMUST00000199673.6" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000148703.2", "url": "https://www.ensembl.org/id/ENSMUSP00000148703.2" } ] } }, { "isoform_ac": "Q3UQ40-1", "url": "", "sequence": { "sequence": "SILSPTGLMLDGTSRFTCRGKKIYNIMGTSTFTEYTVVHEIAVAKIEAAAPMDTVCIMSCAVPTGFGAVFNTAQVTPGSSCVVFGLGGIGSAIVMACKASGACRIIGVDINEEKFPRARALGVTDCLNPNKLKKPVQEVVKEMTGVGVDFAFEAIGLIETMVAALKSCNRSYGVCVIMGVAPTGSQLSFDPLVLLPGRTLKSSVLGGYKTRDDIPKLVTDYVQKKINIDPLITHRLPFPKINEGFRLLQEGKW", "length": 253, "header": "tr|Q3UQ40-1|Q3UQ40_MOUSE Computationally mapped isoform of Alcohol dehydrogenase 6B (class V) OS=Mus musculus OX=10090 GN=Adh6b PE=2 SV=1 CANONICAL=A0A1D5RMB0-1" }, "locus": { "chromosome": "3", "start_pos": 138063547, "end_pos": 138058139, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000090166.5", "url": "https://www.ensembl.org/id/ENSMUST00000090166.5" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000148627.2", "url": "https://www.ensembl.org/id/ENSMUSP00000148627.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "alcohol dehydrogenase (NAD+) activity", "id": "GO:0004022", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004022", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5RMB0", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5RMB0", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0" } ], "pmid": "" }, { "name": "alcohol dehydrogenase activity, zinc-dependent", "id": "GO:0004024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004024", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5RMB0", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0" } ], "pmid": "" }, { "name": "NAD-retinol dehydrogenase activity", "id": "GO:0004745", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004745", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5RMB0", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5RMB0", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "ethanol oxidation", "id": "GO:0006069", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006069", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5RMB0", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0" } ], "pmid": "" }, { "name": "response to ethanol", "id": "GO:0045471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045471", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5RMB0", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0" } ], "pmid": "" }, { "name": "retinol metabolic process", "id": "GO:0042572", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042572", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5RMB0", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0" } ], "pmid": "" }, { "name": "retinoic acid metabolic process", "id": "GO:0042573", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042573", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5RMB0", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0" } ], "pmid": "" }, { "name": "organic substance catabolic process", "id": "GO:1901575", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901575", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5RMB0", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0" } ], "pmid": "" }, { "name": "small molecule catabolic process", "id": "GO:0044282", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044282", "evidence": [ { "database": "UniProtKB", "id": "A0A1D5RMB0", "url": "https://www.uniprot.org/uniprot/A0A1D5RMB0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 291, "end_pos": 293, "annotation": "n_glycosylation_sequon" }, { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }