{ "uniprot_canonical_ac": "A0A1B0GSZ0-1", "uniprot_ac": "A0A1B0GSZ0", "uniprot_id": "SPAR_MOUSE", "mass": { "chemical_mass": 8470.0, "monoisotopic_mass": 8470.0 }, "refseq": {}, "gene_names": [ { "name": "Spaar", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "id": "A0A1B0GSZ0" }, { "name": "Spar", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "id": "A0A1B0GSZ0" } ], "protein_names": [ { "name": "Small regulatory polypeptide of amino acid response", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A1B0GSZ0" } ], "function": [ { "annotation": "Negative regulator of amino acid sensing and mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels and amino acids (By similarity). Negatively regulates mTORC1 activation by inhibiting recruitment of mTORC1 to lysosomes upon stimulation with amino acids: acts by promoting the formation of a tightly bound supercomplex composed of the lysosomal V-ATPase, Ragulator and Rag GTPases, preventing recruitment of mTORC1 (By similarity). Acts as a regulator of muscle regeneration following injury by regulating mTORC1 activation (PubMed:28024296).", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0#function" }, { "database": "PubMed", "id": "28024296", "url": "https://glygen.org/publication/PubMed/28024296" }, { "database": "UniProtKB", "id": "A0A1B0GVQ0", "url": "https://www.uniprot.org/uniprot/A0A1B0GVQ0#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Spaar", "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "locus": { "chromosome": "4", "start_pos": 43759462, "end_pos": 43730034, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000028475", "url": "https://www.ensembl.org/id/ENSMUSG00000028475" } ] } } ], "crossref": [ { "id": "ENSMUSG00000028475", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000028475", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "mmu:71406", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:71406", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1918656", "url": "http://www.informatics.jax.org/marker/MGI:1918656", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "SQWAMET", "url": "https://omabrowser.org/oma/group/SQWAMET/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5261777at2759", "url": "http://www.orthodb.org/?query=5261777at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A1B0GSZ0", "url": "http://purl.obolibrary.org/obo/PR_A0A1B0GSZ0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GSZ0-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "METAVIGMVAVLFVITMAITCILCYFSYDSHTQDPERSSRRSFTVATFHQEASLFTGPALQSRPLPRPQNFWTVV", "length": 75, "header": "sp|A0A1B0GSZ0-1|SPAR_MOUSE Isoform 1 of Small regulatory polypeptide of amino acid response OS=Mus musculus OX=10090 GN=Spaar PE=1 SV=1 CANONICAL=A0A1B0GSZ0-1" }, "isoforms": [ { "isoform_ac": "A0A1B0GSZ0-1", "url": "", "sequence": { "sequence": "METAVIGMVAVLFVITMAITCILCYFSYDSHTQDPERSSRRSFTVATFHQEASLFTGPALQSRPLPRPQNFWTVV", "length": 75, "header": "sp|A0A1B0GSZ0-1|SPAR_MOUSE Isoform 1 of Small regulatory polypeptide of amino acid response OS=Mus musculus OX=10090 GN=Spaar PE=1 SV=1 CANONICAL=A0A1B0GSZ0-1" }, "locus": { "chromosome": "4", "start_pos": 43731189, "end_pos": 43730965, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000131248", "url": "https://www.ensembl.org/id/ENSMUST00000131248" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000148128", "url": "https://www.ensembl.org/id/ENSMUSP00000148128" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "mTORC1 and muscle regeneration are regulated by the LINC00961-encoded SPAR polypeptide.", "journal": "Nature", "date": "2017", "authors": "Matsumoto A, Pasut A, Matsumoto M, Yamashita R, Fung J, Monteleone E, Saghatelian A, Nakayama KI, Clohessy JG, Pandolfi PP", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0" } ], "reference": [ { "type": "PubMed", "id": "28024296", "url": "https://glygen.org/publication/PubMed/28024296" } ] } ], "pathway": [ { "id": "mmu:71406", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:71406", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0" } ], "pmid": "" }, { "name": "lysosomal proton-transporting V-type ATPase complex", "id": "GO:0046611", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046611", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "cellular response to amino acid stimulus", "id": "GO:0071230", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071230", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0" } ], "pmid": "" }, { "name": "regulation of skeletal muscle tissue regeneration", "id": "GO:0043416", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043416", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0" } ], "pmid": "" }, { "name": "negative regulation of TORC1 signaling", "id": "GO:1904262", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904262", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GSZ0", "url": "https://www.uniprot.org/uniprot/A0A1B0GSZ0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }