{ "uniprot_canonical_ac": "A0A1B0GS75-1", "uniprot_ac": "A0A1B0GS75", "uniprot_id": "A0A1B0GS75_MOUSE", "mass": { "chemical_mass": 13875.0, "monoisotopic_mass": 13875.0 }, "refseq": { "ac": "NP_001028804", "name": "interferon induced transmembrane protein 6", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001028804" }, "gene_names": [ { "name": "Ifitm6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A1B0GS75", "id": "A0A1B0GS75" }, { "name": "A330075D07; Dspa2f; Fgls5; fragilis5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001028804", "id": "NP_001028804" }, { "name": "Ifitm6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001028804", "id": "NP_001028804" } ], "protein_names": [ { "name": "Interferon induced transmembrane protein 6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A1B0GS75" }, { "name": "fragilis 5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001028804", "id": "NP_001028804" }, { "name": "interferon induced transmembrane protein 6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001028804", "id": "NP_001028804" } ], "function": [ { "annotation": "The increase in IFITM6 expression may be involved in macrophage functions of tumor-bearing mice.", "evidence": [ { "database": "RefSeq", "id": "NP_001028804", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001028804" }, { "database": "PubMed", "id": "21165565", "url": "https://glygen.org/publication/PubMed/21165565" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GS75", "url": "https://www.uniprot.org/uniprot/A0A1B0GS75" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ifitm6", "url": "https://www.uniprot.org/uniprot/A0A1B0GS75", "locus": { "chromosome": "7", "start_pos": 140595612, "end_pos": 140597837, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000059108", "url": "https://www.ensembl.org/id/ENSMUSG00000059108" } ] } } ], "crossref": [ { "id": "ENSMUSG00000059108", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000059108", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "213002", "url": "https://www.ncbi.nlm.nih.gov/gene/213002", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR007593", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007593", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:213002", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:213002", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2686976", "url": "http://www.informatics.jax.org/marker/MGI:2686976", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "FIAYIFS", "url": "https://omabrowser.org/oma/group/FIAYIFS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5322528at2759", "url": "http://www.orthodb.org/?query=5322528at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13999", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13999", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13999:SF22", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13999:SF22", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04505", "url": "http://pfam.xfam.org/family/PF04505", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-198933", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "A0A1B0GS75", "url": "https://www.uniprot.org/uniprot/A0A1B0GS75", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GS75-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GS75-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3SXF0", "url": "https://www.uniprot.org/uniprot/Q3SXF0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3SXF0-1", "url": "https://www.uniprot.org/uniprot/Q3SXF0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAVICSFLWPWSEASQPHKNMVKRDPDSAPVPSTVVCINSDVIQPDHITWSTFNTVFMNGCCLGFIAYIYSVKSRDRKMVGDMTGAQSHASTAKILNILALVISLIFYIMLIVLYSFNLLGNQR", "length": 124, "header": "tr|A0A1B0GS75-1|A0A1B0GS75_MOUSE Isoform 1 of Interferon induced transmembrane protein 6 OS=Mus musculus OX=10090 GN=Ifitm6 PE=1 SV=1 CANONICAL=A0A1B0GS75-1" }, "isoforms": [ { "isoform_ac": "A0A1B0GS75-1", "url": "", "sequence": { "sequence": "MAVICSFLWPWSEASQPHKNMVKRDPDSAPVPSTVVCINSDVIQPDHITWSTFNTVFMNGCCLGFIAYIYSVKSRDRKMVGDMTGAQSHASTAKILNILALVISLIFYIMLIVLYSFNLLGNQR", "length": 124, "header": "tr|A0A1B0GS75-1|A0A1B0GS75_MOUSE Isoform 1 of Interferon induced transmembrane protein 6 OS=Mus musculus OX=10090 GN=Ifitm6 PE=1 SV=1 CANONICAL=A0A1B0GS75-1" }, "locus": { "chromosome": "7", "start_pos": 140597336, "end_pos": 140595920, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000211330.2", "url": "https://www.ensembl.org/id/ENSMUST00000211330.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000147821.2", "url": "https://www.ensembl.org/id/ENSMUSP00000147821.2" } ] } }, { "isoform_ac": "Q3SXF0-1", "url": "", "sequence": { "sequence": "MVKRDPDSAPVPSTVVCINSDVIQPDHITWSTFNTVFMNGCCLGFIAYIYSVKSRDRKMVGDMTGAQSHASTAKILNILALVISLIFYIMLIVLYSFNLLGNQR", "length": 104, "header": "tr|Q3SXF0-1|Q3SXF0_MOUSE Computationally mapped isoform of Interferon induced transmembrane protein 6 OS=Mus musculus OX=10090 GN=Ifitm6 PE=1 SV=1 CANONICAL=A0A1B0GS75-1" }, "locus": { "chromosome": "7", "start_pos": 140596771, "end_pos": 140595920, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000081924.5", "url": "https://www.ensembl.org/id/ENSMUST00000081924.5" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000080594.4", "url": "https://www.ensembl.org/id/ENSMUSP00000080594.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "IFITM6 expression is increased in macrophages of tumor-bearing mice.", "journal": "Oncology reports", "date": "2011", "authors": "Han JH, Lee S, Park YS, Park JS, Kim KY, Lim JS, Oh KS, Yang Y", "evidence": [ { "database": "RefSeq", "id": "NP_001028804", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001028804" } ], "reference": [ { "type": "PubMed", "id": "21165565", "url": "https://glygen.org/publication/PubMed/21165565" } ] } ], "pathway": [ { "id": "mmu:213002", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:213002", "resource": "KEGG Pathway" }, { "id": "R-MMU-198933", "name": "Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-198933", "resource": "Reactome", "description": "Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GS75", "url": "https://www.uniprot.org/uniprot/A0A1B0GS75" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "defense response to virus", "id": "GO:0051607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051607", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GS75", "url": "https://www.uniprot.org/uniprot/A0A1B0GS75" } ], "pmid": "" }, { "name": "negative regulation of viral genome replication", "id": "GO:0045071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045071", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GS75", "url": "https://www.uniprot.org/uniprot/A0A1B0GS75" } ], "pmid": "" }, { "name": "type I interferon-mediated signaling pathway", "id": "GO:0060337", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060337", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GS75", "url": "https://www.uniprot.org/uniprot/A0A1B0GS75" } ], "pmid": "" }, { "name": "response to type II interferon", "id": "GO:0034341", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034341", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GS75", "url": "https://www.uniprot.org/uniprot/A0A1B0GS75" } ], "pmid": "" }, { "name": "response to interferon-alpha", "id": "GO:0035455", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035455", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GS75", "url": "https://www.uniprot.org/uniprot/A0A1B0GS75" } ], "pmid": "" }, { "name": "response to interferon-beta", "id": "GO:0035456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035456", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GS75", "url": "https://www.uniprot.org/uniprot/A0A1B0GS75" } ], "pmid": "" }, { "name": "negative regulation of viral entry into host cell", "id": "GO:0046597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046597", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GS75", "url": "https://www.uniprot.org/uniprot/A0A1B0GS75" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }