{ "uniprot_canonical_ac": "A0A0U1RPR8-1", "uniprot_ac": "A0A0U1RPR8", "uniprot_id": "GUC2D_MOUSE", "mass": { "chemical_mass": 122528.0, "monoisotopic_mass": 122528.0 }, "refseq": { "ac": "NP_001124165", "name": "guanylate cyclase D precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124165" }, "gene_names": [ { "name": "Gucy2d", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8", "id": "A0A0U1RPR8" }, { "name": "Gucy2d", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124165", "id": "NP_001124165" } ], "protein_names": [ { "name": "Guanylate cyclase D", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0U1RPR8" }, { "name": "4.6.1.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0U1RPR8" }, { "name": "guanylate cyclase D precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124165", "id": "NP_001124165" }, { "name": "guanylate cyclase D; guanylyl cyclase 2d; guanylyl cyclase D; olfactory guanylyl cyclase GC-D", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124165", "id": "NP_001124165" } ], "function": [ { "annotation": "Functions as an olfactory receptor activated by urine odorants, uroguanylin and guanylin and as well by the volatile semiochemicals carbon disulfide (CS2) and carbon dioxide (CO2) (PubMed:17724338, PubMed:17702944, PubMed:20637621). Has guanylate cyclase activity upon binding of the ligand (By similarity). Activation of GUCY2D neurons leads to the cGMP-dependent activation of the CNGA3 channels, membrane depolarization and an increase in action potential frequency (PubMed:17724338, PubMed:20637621). Signaling pathways activated by GUCY2D may trigger social behaviors such as acquisition of food preference (PubMed:20637621).", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8#function" }, { "database": "PubMed", "id": "17702944", "url": "https://glygen.org/publication/PubMed/17702944" }, { "database": "PubMed", "id": "17724338", "url": "https://glygen.org/publication/PubMed/17724338" }, { "database": "PubMed", "id": "20637621", "url": "https://glygen.org/publication/PubMed/20637621" }, { "database": "UniProtKB", "id": "P51839", "url": "https://www.uniprot.org/uniprot/P51839#function" } ] }, { "annotation": "Mg(2+) binding to GCAPs is critical for setting the actual dynamic range of RetGC regulation by GCAPs at physiological levels of free Ca(2+)", "evidence": [ { "database": "RefSeq", "id": "NP_001124165", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124165" }, { "database": "PubMed", "id": "14993224", "url": "https://glygen.org/publication/PubMed/14993224" } ] }, { "annotation": "Sensory neurons expressing the atypical olfactory receptor guanylyl cyclase D are required for the acquisition of odor preferences by mice in diverse social contexts.", "evidence": [ { "database": "RefSeq", "id": "NP_001124165", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124165" }, { "database": "PubMed", "id": "32841674", "url": "https://glygen.org/publication/PubMed/32841674" } ] }, { "annotation": "The S248W mutation contributes to Leber congenital amaurosis 1 by hampering the expression, processing, and/or cellular transport of GUCY2D, rather than its enzymatic properties. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001124165", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124165" }, { "database": "PubMed", "id": "27881908", "url": "https://glygen.org/publication/PubMed/27881908" } ] }, { "annotation": "This mouse model provides the first direct biochemical and physiological in vivo evidence for the Arg(838) substitutions in RetGC1 being the culprit behind the pathogenesis of the CORD6 congenital blindness.", "evidence": [ { "database": "RefSeq", "id": "NP_001124165", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124165" }, { "database": "PubMed", "id": "27703005", "url": "https://glygen.org/publication/PubMed/27703005" } ] } ], "disease": [ { "disease_id": "DOID:14791", "recommended_name": { "id": "DOID:14791", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14791", "name": "Leber congenital amaurosis", "description": "A retinal disease that is characterized by nystagmus, sluggish or no pupillary responses, and severe vision loss or blindness." }, "synonyms": [ { "id": "DOID:14791", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14791", "name": "LCA", "description": "" }, { "id": "DOID:14791", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14791", "name": "Leber's amaurosis", "description": "" }, { "id": "DOID:14791", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14791", "name": "Leber's congenital amaurosis", "description": "" }, { "id": "DOID:14791", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14791", "name": "Leber's disease", "description": "" }, { "id": "MONDO:0008764", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008764", "name": "Leber congenital amaurosis 1", "description": "Any Leber congenital amaurosis in which the cause of the disease is a mutation in the GUCY2D gene." }, { "id": "MONDO:0008764", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008764", "name": "GUCY2D Leber congenital amaurosis", "description": "" }, { "id": "MONDO:0008764", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008764", "name": "LCA1", "description": "" }, { "id": "MONDO:0008764", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008764", "name": "Leber congenital amaurosis 1", "description": "" }, { "id": "MONDO:0008764", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008764", "name": "Leber congenital amaurosis caused by mutation in GUCY2D", "description": "" }, { "id": "MONDO:0008764", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008764", "name": "Leber congenital amaurosis type 1", "description": "" }, { "id": "MONDO:0008764", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008764", "name": "amaurosis congenita of Leber I", "description": "" }, { "id": "MONDO:0008764", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008764", "name": "CRB", "description": "" }, { "id": "MONDO:0008764", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008764", "name": "LCA", "description": "" }, { "id": "MONDO:0008764", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008764", "name": "amaurosis congenita of Leber 1", "description": "" }, { "id": "MONDO:0008764", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008764", "name": "amaurosis congenita of Leber, type 1", "description": "" }, { "id": "MONDO:0008764", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008764", "name": "retinal blindness, congenital", "description": "" }, { "id": "MIM:204000", "resource": "MIM", "url": "https://www.omim.org/entry/204000", "name": "Leber congenital amaurosis 1", "description": "Leber congenital amaurosis 1" } ], "evidence": [ { "id": "14791", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:14791" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gucy2d", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8", "locus": { "chromosome": "7", "start_pos": 98126686, "end_pos": 98089623, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000074003", "url": "https://www.ensembl.org/id/ENSMUSG00000074003" } ] } } ], "crossref": [ { "id": "ENSMUSG00000074003", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000074003", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd06371", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06371", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd07302", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07302", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd14043", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14043", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "14918", "url": "https://www.ncbi.nlm.nih.gov/gene/14918", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000719", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000719", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001054", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001054", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001245", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001245", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001828", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001828", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011009", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011009", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018297", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018297", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028082", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028082", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029787", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029787", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:14918", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14918", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "106030", "url": "http://www.informatics.jax.org/marker/MGI:106030", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "YDTMLFA", "url": "https://omabrowser.org/oma/group/YDTMLFA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3683909at2759", "url": "http://www.orthodb.org/?query=3683909at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11920", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11920", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11920:SF477", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11920:SF477", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00211", "url": "http://pfam.xfam.org/family/PF00211", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01094", "url": "http://pfam.xfam.org/family/PF01094", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07714", "url": "http://pfam.xfam.org/family/PF07714", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A0U1RPR8", "url": "http://purl.obolibrary.org/obo/PR_A0A0U1RPR8", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001124165", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124165", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "13665", "url": "https://www.rhea-db.org/rhea/13665", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0U1RPB5", "url": "https://www.uniprot.org/uniprot/A0A0U1RPB5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RPB5-1", "url": "https://www.uniprot.org/uniprot/A0A0U1RPB5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RPR8-1", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6VFS9", "url": "https://www.uniprot.org/uniprot/F6VFS9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6VFS9-1", "url": "https://www.uniprot.org/uniprot/F6VFS9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGLQQGCHFEGQNWTAPHWKTCLPCQGPWRLTVSHLKTVSSISVLSVVFWSVLLWADSLSLLAWARETFTLGVLGPWDCDPIFAQALPSIATQLAVDQVNQDASLLPGSQLDFKVLPTGCDTPHALATFVAHKNIVAAFVGPVNPGFCSAAALLAQGWGKSLFSWACEAPEGGGDLVPTLPSAADVLLSVMRHFGWARWAIVSSHQDIWVTTAQQLATAFRTHGLPIGLVTSLGPGEKGATEVCKQLHSVHGLKIVVLCMHSALLGGLEQTTLLHCAWEEGLTDGRLVFLPYDTLLFALPYGNRSYLVLDDHGPLQEAYDAVLTVSLESSPESHAFTATEMSGGATANLEPEQVSPLFGTIYDAVILLAHALNRSETHGAGLSGAHLGDHVRALDVAGFSQRIRTDGKGRRLAQYVILDTDGEGSQLVPTHILDTSTWQVQPLGKPIHFPGGSPPAHDASCWFDPNTLCIRGVQPLGSLLTLTIACVLALVGGFLAYFIRLGLQQLRLLRGPHRILLTSQELTFLQRTPSRRRPHVDSGSESRSVVDGGSPRSVTQGSARSLPAFLEHTNVALYQGEWVWLKKFEAGVAPDLRPSSLSFLRKLREMRHENVTAFLGLFVGPGVSAMVLEHCARGSLEDLLQNENLRLDWTFKASLLLDLIRGLRYLHHRRFPHGRLKSRNCVVDTRFVLKITDHGYAEFLESHCSSRPQPAPEELLWTAPELLRGPGKATFKGDVFSLAIILQEVLTRDPPYCSWGLSAEEIIRKVASPPPLCRPLVSPDQGPLECIQLMQLCWEEAPDDRPSLDQIYTQFKSINQGKKTSVVDSMLRMLEKYSESLEDLVQERTEELELERRKTERLLSQMLPPSVAHALKMGTTVEPEYFDQVTIYFSDIVGFTTISALSEPIEVVGFLNDLYTLFDAVLDSHDVYKVETIGDAYMVASGLPRRNGNRHAAEIANLALDILSYAGNFRMRHAPDVPIRVRAGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSQSTVQALLSLDEGYKIDVRGQTELKGKGLEETYWLTGKVGFCRPLPTPLSIKPGDPWQDRINQEIRTGFAKARQGLAEPRKSGEAGPGP", "length": 1117, "header": "sp|A0A0U1RPR8-1|GUC2D_MOUSE Isoform 1 of Guanylate cyclase D OS=Mus musculus OX=10090 GN=Gucy2d PE=2 SV=1 CANONICAL=A0A0U1RPR8-1" }, "isoforms": [ { "isoform_ac": "A0A0U1RPB5-1", "url": "", "sequence": { "sequence": "PIEVVGFLNDLYTLFDAVLDSHDVYKVETIGDAYMVASGLPRRNGNRHAAEIANLALDILSYAGNFRMRHAPDVPIRVRAGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSQSTVQALLSLDEGYKIDVRGQTELKGKGLEETYWLTGKVGFCRPLPTPLSIKPG", "length": 178, "header": "tr|A0A0U1RPB5-1|A0A0U1RPB5_MOUSE Computationally mapped isoform of Guanylate cyclase 2d OS=Mus musculus OX=10090 GN=Gucy2d PE=3 SV=1 CANONICAL=A0A0U1RPR8-1" }, "locus": { "chromosome": "7", "start_pos": 98123950, "end_pos": 98116901, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000205350.2", "url": "https://www.ensembl.org/id/ENSMUST00000205350.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000145913.2", "url": "https://www.ensembl.org/id/ENSMUSP00000145913.2" } ] } }, { "isoform_ac": "A0A0U1RPR8-1", "url": "", "sequence": { "sequence": "MAGLQQGCHFEGQNWTAPHWKTCLPCQGPWRLTVSHLKTVSSISVLSVVFWSVLLWADSLSLLAWARETFTLGVLGPWDCDPIFAQALPSIATQLAVDQVNQDASLLPGSQLDFKVLPTGCDTPHALATFVAHKNIVAAFVGPVNPGFCSAAALLAQGWGKSLFSWACEAPEGGGDLVPTLPSAADVLLSVMRHFGWARWAIVSSHQDIWVTTAQQLATAFRTHGLPIGLVTSLGPGEKGATEVCKQLHSVHGLKIVVLCMHSALLGGLEQTTLLHCAWEEGLTDGRLVFLPYDTLLFALPYGNRSYLVLDDHGPLQEAYDAVLTVSLESSPESHAFTATEMSGGATANLEPEQVSPLFGTIYDAVILLAHALNRSETHGAGLSGAHLGDHVRALDVAGFSQRIRTDGKGRRLAQYVILDTDGEGSQLVPTHILDTSTWQVQPLGKPIHFPGGSPPAHDASCWFDPNTLCIRGVQPLGSLLTLTIACVLALVGGFLAYFIRLGLQQLRLLRGPHRILLTSQELTFLQRTPSRRRPHVDSGSESRSVVDGGSPRSVTQGSARSLPAFLEHTNVALYQGEWVWLKKFEAGVAPDLRPSSLSFLRKLREMRHENVTAFLGLFVGPGVSAMVLEHCARGSLEDLLQNENLRLDWTFKASLLLDLIRGLRYLHHRRFPHGRLKSRNCVVDTRFVLKITDHGYAEFLESHCSSRPQPAPEELLWTAPELLRGPGKATFKGDVFSLAIILQEVLTRDPPYCSWGLSAEEIIRKVASPPPLCRPLVSPDQGPLECIQLMQLCWEEAPDDRPSLDQIYTQFKSINQGKKTSVVDSMLRMLEKYSESLEDLVQERTEELELERRKTERLLSQMLPPSVAHALKMGTTVEPEYFDQVTIYFSDIVGFTTISALSEPIEVVGFLNDLYTLFDAVLDSHDVYKVETIGDAYMVASGLPRRNGNRHAAEIANLALDILSYAGNFRMRHAPDVPIRVRAGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSQSTVQALLSLDEGYKIDVRGQTELKGKGLEETYWLTGKVGFCRPLPTPLSIKPGDPWQDRINQEIRTGFAKARQGLAEPRKSGEAGPGP", "length": 1117, "header": "sp|A0A0U1RPR8-1|GUC2D_MOUSE Isoform 1 of Guanylate cyclase D OS=Mus musculus OX=10090 GN=Gucy2d PE=2 SV=1 CANONICAL=A0A0U1RPR8-1" }, "locus": { "chromosome": "7", "start_pos": 98126496, "end_pos": 98089716, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000206435", "url": "https://www.ensembl.org/id/ENSMUST00000206435" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000146093", "url": "https://www.ensembl.org/id/ENSMUSP00000146093" } ] } }, { "isoform_ac": "F6VFS9-1", "url": "", "sequence": { "sequence": "SGLQQGCHFEGQNWTAPHWKTCLPCQGPWRLTVSHLKTVSSISVLSVVFWSVLLWADSLSLLAWARETFTLGVLGPWDCDPIFAQALPSIATQLAVDQVNQDASLLPGSQLDFKVLPTGCDTPHALATFVAHKNIVAAFVGPVNPGFCSAAALLAQGWGKSLFSWACEAPEGGGDLVPTLPSAADVLLSVMRHFGWARWAIVSSHQDIWVTTAQQLATAFRTHGLPIGLVTSLGPGEKGATEVCKQLHSVHGLKIVVLCMHSALLGGLEQTTLLHCAWEEGLTDGRLVFLPYDTLLFALPYGNRSYLVLDDHGPLQEAYDAVLTVSLESSPESHAFTATEMSGGATANLEPEQVSPLFGTIYDAVILLAHALNRSETHGAGLSGAHLGDHVRALDVAGFSQRIRTDGKGRRLAQYVILDTDGEGSQLVPTHILDTSTWQVQPLGKPIHFPGGSPPAHDASCWFDPNTLCIRGVQPLGSLLTLTIACVLALVGGFLAYFIRLGLQQLRLLRGPHRILLTSQELTFLQRTPSRRRPHVDSGSESRSVVDGGSPRSVTQGSARSLPAFLEHTNVALYQGEWVWLKKFEAGVAPDLRPSSLSFLRKLREMRHENVTAFLGLFVGPGVSAMVLEHCARGSLEDLLQNENLRLDWTFKASLLLDLIRGLRYLHHRRFPHGRLKSRNCVVDTRFVLKITDHGYAEFLESHCSSRPQPAPEELLWTAPELLRGPGKATFKGDVFSLAIILQEVLTRDPPYCSWGLSAEEIIRKVASPPPLCRPLVSPDQGPLECIQLMQLCWEEAPDDRPSLDQIYTQFKSINQGKKTSVVDSMLRMLEKYSESLEDLVQERTEELELERRKTERLLSQMLPPSVAHALKMGTTVEPEYFDQVTIYFSDIVGFTTISALSEPIEVVGFLNDLYTLFDAVLDSHDVYKVETIGDAYMVASGLPRRNGNRHAAEIANLALDILSYAGNFRMRHAPDVPIRVRAGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSQSTVQALLSLDEGYKIDVRGQTELKGKGLEETYWLTGKVGFCRPLPTPLSIKPGDPWQDRINQEIRTGFAKARQGLAEPRKSGEAGPGP", "length": 1116, "header": "tr|F6VFS9-1|GUC2D_MOUSE Computationally mapped isoform of Guanylate cyclase D OS=Mus musculus OX=10090 GN=Gucy2d PE=2 SV=1 CANONICAL=A0A0U1RPR8-1" }, "locus": { "chromosome": "7", "start_pos": 98126496, "end_pos": 98092628, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000098274.5", "url": "https://www.ensembl.org/id/ENSMUST00000098274.5" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000095875.4", "url": "https://www.ensembl.org/id/ENSMUSP00000095875.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Guanylyl cyclase-activating proteins (GCAPs) are Ca2+/Mg2+ sensors: implications for photoreceptor guanylyl cyclase (RetGC) regulation in mammalian photoreceptors.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Peshenko IV, Dizhoor AM", "evidence": [ { "database": "RefSeq", "id": "NP_001124165", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124165" } ], "reference": [ { "type": "PubMed", "id": "14993224", "url": "https://glygen.org/publication/PubMed/14993224" } ] }, { "title": "Detection of near-atmospheric concentrations of CO2 by an olfactory subsystem in the mouse.", "journal": "Science (New York, N.Y.)", "date": "2007-08-17", "authors": "Hu Ji, Zhong Chun, Ding Cheng, Chi Qiuyi, Walz Andreas, Mombaerts Peter, Matsunami Hiroaki, Luo Minmin", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "reference": [ { "type": "PubMed", "id": "17702944", "url": "https://glygen.org/publication/PubMed/17702944" } ] }, { "title": "Contribution of the receptor guanylyl cyclase GC-D to chemosensory function in the olfactory epithelium.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007-09-04", "authors": "Leinders-Zufall Trese, Cockerham Renee E, Michalakis Stylianos, Biel Martin, Garbers David L, Reed Randall R, Zufall Frank, Munger Steven D", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "reference": [ { "type": "PubMed", "id": "17724338", "url": "https://glygen.org/publication/PubMed/17724338" } ] }, { "title": "An olfactory subsystem that detects carbon disulfide and mediates food-related social learning.", "journal": "Current biology : CB", "date": "2010-08-24", "authors": "Munger Steven D, Leinders-Zufall Trese, McDougall Lisa M, Cockerham Renee E, Schmid Andreas, Wandernoth Petra, Wennemuth Gunther, Biel Martin, Zufall Frank, Kelliher Kevin R", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "reference": [ { "type": "PubMed", "id": "20637621", "url": "https://glygen.org/publication/PubMed/20637621" } ] }, { "title": "The R838S Mutation in Retinal Guanylyl Cyclase 1 (RetGC1) Alters Calcium Sensitivity of cGMP Synthesis in the Retina and Causes Blindness in Transgenic Mice.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Dizhoor AM, Olshevskaya EV, Peshenko IV", "evidence": [ { "database": "RefSeq", "id": "NP_001124165", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124165" } ], "reference": [ { "type": "PubMed", "id": "27703005", "url": "https://glygen.org/publication/PubMed/27703005" } ] }, { "title": "Functional study of two biochemically unusual mutations in GUCY2D Leber congenital amaurosis expressed via adenoassociated virus vector in mouse retinas.", "journal": "Molecular vision", "date": "2016", "authors": "Boye SL, Olshevskaya EV, Peshenko IV, McCullough KT, Boye SE, Dizhoor AM", "evidence": [ { "database": "RefSeq", "id": "NP_001124165", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124165" } ], "reference": [ { "type": "PubMed", "id": "27881908", "url": "https://glygen.org/publication/PubMed/27881908" } ] }, { "title": "Sensory neurons expressing the atypical olfactory receptor guanylyl cyclase D are required for the acquisition of odor preferences by mice in diverse social contexts.", "journal": "Physiology & behavior", "date": "2020", "authors": "Zimmerman AD, Nagy CR, Munger SD", "evidence": [ { "database": "RefSeq", "id": "NP_001124165", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001124165" } ], "reference": [ { "type": "PubMed", "id": "32841674", "url": "https://glygen.org/publication/PubMed/32841674" } ] }, { "title": "A subset of olfactory neurons that selectively express cGMP-stimulated phosphodiesterase (PDE2) and guanylyl cyclase-D define a unique olfactory signal transduction pathway.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1997", "authors": "Juilfs D M, F\u00fclle H J, Zhao A Z, Houslay M D, Garbers D L, Beavo J A", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "reference": [ { "type": "PubMed", "id": "9096404", "url": "https://glygen.org/publication/PubMed/9096404" } ] } ], "pathway": [ { "id": "mmu:14918", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14918", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P51839-1", "protein_name": "Guanylate cyclase 2D", "gene_name": "Gucy2d", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAGLQQGCHPEGQDWTAPHWKTCRPCQGPRGLTVRHLRTVSSISVFSVVFWGVLLWADSLSLPAWARETFTLGVLGPWDCDPIFAQALPSMATQLAVDRVNQDASLLLGSQLDFKILPTGCDTPHALATFVAHRNTVAAFIGPVNPGYCPAAALLAQGWGKSLFSWACGAPEGGGALVPTLPSMADVLLSVMRHFGWARLAIVSSHQDIWVTTAQQLATAFRAHGLPIGLITSLGPGEKGATEVCKQLHSVHGLKIVVLCMHSALLGGLEQTVLLRCARKEGLTDGRLVFLPYDTLLFALPYRNRSYLVLDDDGPLQEAYDAVLTISLDTSPESHAFTATKMRGGTAANLGPEQVSPLFGTIYDAVILLAHALNHSEAHGTGLSGAHLGNHIRALDVAGFSQRIRIDGKGRRLPQYVILDTNGEGSQLVPTHILDVSTQQVQPLGTAVHFPGGSPPARDASCWFDPNTLCIRGVQPLGSLLTLTITCVLALVGGFLAYFIRLGLQQLRLLRGPHRILLTPQELTFLQRTPSRRRPHVDSGSESRSVVDGGSPQSVIQGSTRSVPAFLEHTNVALYQGEWVWLKKFEAGTAPDLRPSSLSLLRKMREMRHENVTAFLGLFVGPEVSAMVLEHCARGSLEDLLRNEDLRLDWTFKASLLLDLIRGLRYLHHRHFPHGRLKSRNCVVDTRFVLKITDHGYAEFLESHCSFRPQPAPEELLWTAPELLRGPRRPWGPGKATFKGDVFSLGIILQEVLTRDPPYCSWGLSAEEIIRKVASPPPLCRPLVSPDQGPLECIQLMQLCWEEAPDDRPSLDQIYTQFKSINQGKKTSVADSMLRMLEKYSQSLEGLVQERTEELELERRKTERLLSQMLPPSVAHALKMGTTVEPEYFDQVTIYFSDIVGFTTISALSEPIEVVGFLNDLYTMFDAVLDSHDVYKVETIGDAYMVASGLPRRNGNRHAAEIANMALEILSYAGNFRMRHAPDVPIRVRAGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSRNTVQALLSLDEGYKIDVRGQTELKGKGLEETYWLTGKTGFCRSLPTPLSIQPGDPWQDHINQEIRTGFAKLARVG", "length": 1110 }, "evidence": [ { "id": "45224438", "url": "http://www.informatics.jax.org/homology/45224438", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 9, "go_terms": [ { "name": "guanylate cyclase activity", "id": "GO:0004383", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004383", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "protein kinase activity", "id": "GO:0004672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004672", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "phosphorus-oxygen lyase activity", "id": "GO:0016849", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016849", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "adenylate cyclase activity", "id": "GO:0004016", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004016", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "natriuretic peptide receptor activity", "id": "GO:0016941", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016941", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "odorant binding", "id": "GO:0005549", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005549", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "peptide receptor activity", "id": "GO:0001653", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001653", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "protein phosphorylation", "id": "GO:0006468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006468", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "intracellular signal transduction", "id": "GO:0035556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035556", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "cyclic nucleotide biosynthetic process", "id": "GO:0009190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009190", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "olfactory behavior", "id": "GO:0042048", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042048", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "cGMP biosynthetic process", "id": "GO:0006182", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006182", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "receptor guanylyl cyclase signaling pathway", "id": "GO:0007168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007168", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "sensory perception of smell", "id": "GO:0007608", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "olfactory learning", "id": "GO:0008355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008355", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "detection of chemical stimulus involved in sensory perception of smell", "id": "GO:0050911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050911", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "positive regulation of cGMP-mediated signaling", "id": "GO:0010753", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010753", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "detection of carbon dioxide", "id": "GO:0003031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003031", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "non-motile cilium", "id": "GO:0097730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097730", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" }, { "name": "ciliary membrane", "id": "GO:0060170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060170", "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RPR8", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 14, "end_pos": 16, "annotation": "n_glycosylation_sequon" }, { "start_pos": 304, "end_pos": 306, "annotation": "n_glycosylation_sequon" }, { "start_pos": 374, "end_pos": 376, "annotation": "n_glycosylation_sequon" }, { "start_pos": 611, "end_pos": 613, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "13665", "name": "", "equation": "GTP = 3',5'-cyclic GMP + diphosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P16067-1", "P18910-1", "P22717-1", "P51842-1", "P19686-1", "P20595-1", "P55205-1", "Q9WVI4-1", "P23897-1", "P51840-1", "P51839-1", "P16066-1", "P20594-1", "P51841-1", "P33402-1", "O75343-1", "Q02108-1", "Q02153-1", "Q02846-1", "P25092-1", "P18293-1", "Q6VVW5-1", "O54865-1", "Q5SDA5-1", "Q9ERL9-1", "P52785-1", "Q3UWA6-1", "Q6TL19-1", "A0A0U1RPR8-1", "Q553Y7-1", "Q07093-1", "Q9VU79-1", "Q7JQ32-1", "Q8INF0-1", "Q07553-1", "A0A4D6K026-1", "Q9VEU5-1", "Q9VEU6-1", "Q8MLX0-1", "Q9VF17-1" ], "evidence": [ { "id": "13665", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/13665" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0U1RPR8", "gene_name": "Gucy2d", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "A0A0U1RPR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "A0A0U1RPR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0U1RPR8" } ] } ] }, { "uniprot_ac": "A0A4D6K026", "gene_name": "CG9783", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "A0A4D6K026", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A4D6K026" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "A0A4D6K026", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A4D6K026" } ] } ] }, { "uniprot_ac": "O54865", "gene_name": "Gucy1b1", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "O54865", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54865" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "O54865", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54865" } ] } ] }, { "uniprot_ac": "O75343", "gene_name": "GUCY1B2", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "O75343", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75343" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "O75343", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75343" } ] } ] }, { "uniprot_ac": "P16066", "gene_name": "NPR1", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P16066", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16066" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P16066", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16066" } ] } ] }, { "uniprot_ac": "P16067", "gene_name": "Npr2", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P16067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16067" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P16067", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16067" } ] } ] }, { "uniprot_ac": "P18293", "gene_name": "Npr1", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P18293", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18293" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P18293", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18293" } ] } ] }, { "uniprot_ac": "P18910", "gene_name": "Npr1", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P18910", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18910" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P18910", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18910" } ] } ] }, { "uniprot_ac": "P19686", "gene_name": "Gucy1a1", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P19686", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19686" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P19686", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19686" } ] } ] }, { "uniprot_ac": "P20594", "gene_name": "NPR2", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P20594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20594" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P20594", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20594" } ] } ] }, { "uniprot_ac": "P20595", "gene_name": "Gucy1b1", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P20595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20595" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P20595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20595" } ] } ] }, { "uniprot_ac": "P22717", "gene_name": "Gucy1b2", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P22717", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22717" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P22717", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22717" } ] } ] }, { "uniprot_ac": "P23897", "gene_name": "Gucy2c", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P23897", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23897" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P23897", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23897" } ] } ] }, { "uniprot_ac": "P25092", "gene_name": "GUCY2C", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P25092", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25092" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P25092", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25092" } ] } ] }, { "uniprot_ac": "P33402", "gene_name": "GUCY1A2", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P33402", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33402" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P33402", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33402" } ] } ] }, { "uniprot_ac": "P51839", "gene_name": "Gucy2d", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P51839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51839" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P51839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51839" } ] } ] }, { "uniprot_ac": "P51840", "gene_name": "Gucy2e", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P51840", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51840" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P51840", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51840" } ] } ] }, { "uniprot_ac": "P51841", "gene_name": "GUCY2F", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P51841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51841" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P51841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51841" } ] } ] }, { "uniprot_ac": "P51842", "gene_name": "Gucy2f", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P51842", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51842" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P51842", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51842" } ] } ] }, { "uniprot_ac": "P52785", "gene_name": "Gucy2e", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P52785", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52785" } ] } ] }, { "uniprot_ac": "P55205", "gene_name": "Gucy2g", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "P55205", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55205" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "P55205", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55205" } ] } ] }, { "uniprot_ac": "Q02108", "gene_name": "GUCY1A1", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q02108", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02108" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q02108", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02108" } ] } ] }, { "uniprot_ac": "Q02153", "gene_name": "GUCY1B1", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q02153", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02153" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q02153", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02153" } ] } ] }, { "uniprot_ac": "Q02846", "gene_name": "GUCY2D", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q02846", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02846" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q02846", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02846" } ] } ] }, { "uniprot_ac": "Q07093", "gene_name": "Gycalpha99B", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q07093", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07093" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q07093", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07093" } ] } ] }, { "uniprot_ac": "Q07553", "gene_name": "Gyc32E", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q07553", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07553" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q07553", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07553" } ] } ] }, { "uniprot_ac": "Q3UWA6", "gene_name": "Gucy2c", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q3UWA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UWA6" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q3UWA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UWA6" } ] } ] }, { "uniprot_ac": "Q553Y7", "gene_name": "gca", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q553Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q553Y7" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q553Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q553Y7" } ] } ] }, { "uniprot_ac": "Q5SDA5", "gene_name": "Gucy2f", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q5SDA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SDA5" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q5SDA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SDA5" } ] } ] }, { "uniprot_ac": "Q6TL19", "gene_name": "Gucy2g", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q6TL19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6TL19" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q6TL19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6TL19" } ] } ] }, { "uniprot_ac": "Q6VVW5", "gene_name": "Npr2", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q6VVW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6VVW5" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q6VVW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6VVW5" } ] } ] }, { "uniprot_ac": "Q7JQ32", "gene_name": "Gyc76C", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q7JQ32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JQ32" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q7JQ32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JQ32" } ] } ] }, { "uniprot_ac": "Q8INF0", "gene_name": "Gyc88E", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q8INF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8INF0" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q8INF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8INF0" } ] } ] }, { "uniprot_ac": "Q8MLX0", "gene_name": "Dmel\\CG3216", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q8MLX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MLX0" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q8MLX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MLX0" } ] } ] }, { "uniprot_ac": "Q9ERL9", "gene_name": "Gucy1a1", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q9ERL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERL9" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q9ERL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERL9" } ] } ] }, { "uniprot_ac": "Q9VEU5", "gene_name": "Gyc89Db", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q9VEU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VEU5" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q9VEU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VEU5" } ] } ] }, { "uniprot_ac": "Q9VEU6", "gene_name": "Gyc89Da", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q9VEU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VEU6" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q9VEU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VEU6" } ] } ] }, { "uniprot_ac": "Q9VF17", "gene_name": "CG11846", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q9VF17", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VF17" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q9VF17", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VF17" } ] } ] }, { "uniprot_ac": "Q9VU79", "gene_name": "GYC", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q9VU79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VU79" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q9VU79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VU79" } ] } ] }, { "uniprot_ac": "Q9WVI4", "gene_name": "Gucy1a2", "activity": [ { "ec_number": "4.6.1.2", "activity": "GTP = 3',5'-cyclic GMP + diphosphate.", "evidence": [ { "id": "Q9WVI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVI4" } ] }, { "ec_number": "4.6.1.2", "activity": "", "evidence": [ { "id": "Q9WVI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVI4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }