{ "uniprot_canonical_ac": "A0A0N4SUI7-1", "uniprot_ac": "A0A0N4SUI7", "uniprot_id": "A0A0N4SUI7_MOUSE", "mass": { "chemical_mass": 7026.0, "monoisotopic_mass": 7026.0 }, "refseq": { "ac": "NP_081603", "name": "T helper cell-induced peptide 5", "summary": "The protein encoded by this gene is a 43 aa peptide produced by early activated CD4+ T cells. The encoded protein helps regulate the differentiation of these cells into T helper 2 (Th2) cells. The solution structure of this protein is similar to that of vasoactive intestinal peptide, which plays a role in the differentiation of Th2 cells and Treg cells. [provided by RefSeq, Jun 2012].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081603" }, "gene_names": [ { "name": "Nbdy", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0N4SUI7", "id": "A0A0N4SUI7" }, { "name": "2210013O21Rik; Thp5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081603", "id": "NP_081603" }, { "name": "2210013O21Rik", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0N4SUI7", "id": "A0A0N4SUI7" }, { "name": "Nbdy", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081603", "id": "NP_081603" } ], "protein_names": [ { "name": "Negative regulator of P-body association", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0N4SUI7" }, { "name": "T helper cell-induced peptide 5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081603", "id": "NP_081603" } ], "function": [ { "annotation": "CD4+ T cell-derived novel peptide Thp5 induces interleukin-4 production in CD4+ T cells to direct T helper 2 cell differentiation.", "evidence": [ { "database": "RefSeq", "id": "NP_081603", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081603" }, { "database": "PubMed", "id": "22130674", "url": "https://glygen.org/publication/PubMed/22130674" } ] }, { "annotation": "The protein encoded by this gene is a 43 aa peptide produced by early activated CD4+ T cells. The encoded protein helps regulate the differentiation of these cells into T helper 2 (Th2) cells. The solution structure of this protein is similar to that of vasoactive intestinal peptide, which plays a role in the differentiation of Th2 cells and Treg cells. [provided by RefSeq, Jun 2012].", "evidence": [ { "database": "RefSeq", "id": "NP_081603", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081603" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A0N4SUI7", "url": "https://www.uniprot.org/uniprot/A0A0N4SUI7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Nbdy", "url": "https://www.uniprot.org/uniprot/A0A0N4SUI7", "locus": { "chromosome": "X", "start_pos": 152524916, "end_pos": 152506586, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000086316", "url": "https://www.ensembl.org/id/ENSMUSG00000086316" } ] } } ], "crossref": [ { "id": "ENSMUSG00000086316", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000086316", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd20243", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20243", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "70123", "url": "https://www.ncbi.nlm.nih.gov/gene/70123", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "mmu:70123", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:70123", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1917373", "url": "http://www.informatics.jax.org/marker/MGI:1917373", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "DQPCVSG", "url": "https://omabrowser.org/oma/group/DQPCVSG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A0N4SUI7", "url": "https://www.uniprot.org/uniprot/A0A0N4SUI7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0N4SUI7-1", "url": "https://www.uniprot.org/uniprot/A0A0N4SUI7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LJI0", "url": "https://www.uniprot.org/uniprot/A0A140LJI0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LJI0-1", "url": "https://www.uniprot.org/uniprot/A0A140LJI0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGDQPCASGRSTLPPGNTREPKPPKKRCVLAPRWDYPEGTPSGGSSTLPSAPPPASAGLKSHPPPPEK", "length": 68, "header": "tr|A0A0N4SUI7-1|A0A0N4SUI7_MOUSE Isoform 1 of Negative regulator of P-body association OS=Mus musculus OX=10090 GN=Nbdy PE=1 SV=1 CANONICAL=A0A0N4SUI7-1" }, "isoforms": [ { "isoform_ac": "A0A0N4SUI7-1", "url": "", "sequence": { "sequence": "MGDQPCASGRSTLPPGNTREPKPPKKRCVLAPRWDYPEGTPSGGSSTLPSAPPPASAGLKSHPPPPEK", "length": 68, "header": "tr|A0A0N4SUI7-1|A0A0N4SUI7_MOUSE Isoform 1 of Negative regulator of P-body association OS=Mus musculus OX=10090 GN=Nbdy PE=1 SV=1 CANONICAL=A0A0N4SUI7-1" }, "locus": { "chromosome": "X", "start_pos": 152524260, "end_pos": 152524146, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000140575.8", "url": "https://www.ensembl.org/id/ENSMUST00000140575.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000144699.2", "url": "https://www.ensembl.org/id/ENSMUSP00000144699.2" } ] } }, { "isoform_ac": "A0A140LJI0-1", "url": "", "sequence": { "sequence": "MLKAHLIFSTPLTISLFDCATWRPYLQTEYYDVMTVISPPEFG", "length": 43, "header": "tr|A0A140LJI0-1|A0A0N4SUI7_MOUSE Computationally mapped isoform of Negative regulator of P-body association OS=Mus musculus OX=10090 GN=Nbdy PE=1 SV=1 CANONICAL=A0A0N4SUI7-1" }, "locus": { "chromosome": "X", "start_pos": 152524077, "end_pos": 152508829, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000208235.2", "url": "https://www.ensembl.org/id/ENSMUST00000208235.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000147221.2", "url": "https://www.ensembl.org/id/ENSMUSP00000147221.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "CD4+ T cell-derived novel peptide Thp5 induces interleukin-4 production in CD4+ T cells to direct T helper 2 cell differentiation.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Khan MM, Chatterjee S, Dwivedi VP, Pandey NK, Singh Y, Tousif S, Bhavesh NS, Van Kaer L, Das J, Das G", "evidence": [ { "database": "RefSeq", "id": "NP_081603", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081603" } ], "reference": [ { "type": "PubMed", "id": "22130674", "url": "https://glygen.org/publication/PubMed/22130674" } ] } ], "pathway": [ { "id": "mmu:70123", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:70123", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "P-body", "id": "GO:0000932", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000932", "evidence": [ { "database": "UniProtKB", "id": "A0A0N4SUI7", "url": "https://www.uniprot.org/uniprot/A0A0N4SUI7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "nuclear-transcribed mRNA catabolic process", "id": "GO:0000956", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000956", "evidence": [ { "database": "UniProtKB", "id": "A0A0N4SUI7", "url": "https://www.uniprot.org/uniprot/A0A0N4SUI7" } ], "pmid": "" }, { "name": "negative regulation of cytoplasmic mRNA processing body assembly", "id": "GO:0010607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010607", "evidence": [ { "database": "UniProtKB", "id": "A0A0N4SUI7", "url": "https://www.uniprot.org/uniprot/A0A0N4SUI7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }