{ "uniprot_canonical_ac": "A0A0G2QC52-1", "uniprot_ac": "A0A0G2QC52", "uniprot_id": "A0A0G2QC52_RAT", "mass": { "chemical_mass": 28558.0, "monoisotopic_mass": 28558.0 }, "refseq": { "ac": "XP_006242287", "name": "rab-like protein 2B isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006242287" }, "gene_names": [ { "name": "Rabl2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52", "id": "A0A0G2QC52" }, { "name": "Rabl2a; Rabl2b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006242287", "id": "XP_006242287" }, { "name": "Rabl2a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52", "id": "A0A0G2QC52" }, { "name": "Rabl2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006242287", "id": "XP_006242287" } ], "protein_names": [ { "name": "RAB, member of RAS oncogene family like 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2QC52" }, { "name": "rab-like protein 2B isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006242287", "id": "XP_006242287" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "common_name": "Rat" } ], "gene": [ { "name": "Rabl2", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52", "locus": { "chromosome": "7", "start_pos": 120652175, "end_pos": 120660783, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000013947", "url": "https://www.ensembl.org/id/ENSRNOG00000013947" } ] } } ], "crossref": [ { "id": "ENSRNOG00000013947", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000013947", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd04124", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04124", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "362987", "url": "https://www.ncbi.nlm.nih.gov/gene/362987", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001806", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001806", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041835", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041835", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "DGYKPQQ", "url": "https://omabrowser.org/oma/group/DGYKPQQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "311599at2759", "url": "http://www.orthodb.org/?query=311599at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47978:SF30", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47978:SF30", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00071", "url": "http://pfam.xfam.org/family/PF00071", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_006242287", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006242287", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1306749", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1306749", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2QC52-1", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6G533", "url": "https://www.uniprot.org/uniprot/A0A8I6G533", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6G533-1", "url": "https://www.uniprot.org/uniprot/A0A8I6G533-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKTVTVTEGFHYGDKTPRLTLVHGHELMAGDRSKQGELDQEKYDAHENVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKITYKNLGTWYAELREFRPEIPCILVANKIDADIQMTQKNFSFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVAYKKSSQDFMDEVLQELENFKLEQKEEDTPDQEQGDMSKSPSPS", "length": 250, "header": "tr|A0A0G2QC52-1|A0A0G2QC52_RAT Isoform 1 of RAB, member of RAS oncogene family like 2 OS=Rattus norvegicus OX=10116 GN=Rabl2 PE=1 SV=1 CANONICAL=A0A0G2QC52-1" }, "isoforms": [ { "isoform_ac": "A0A0G2QC52-1", "url": "", "sequence": { "sequence": "MKTVTVTEGFHYGDKTPRLTLVHGHELMAGDRSKQGELDQEKYDAHENVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKITYKNLGTWYAELREFRPEIPCILVANKIDADIQMTQKNFSFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVAYKKSSQDFMDEVLQELENFKLEQKEEDTPDQEQGDMSKSPSPS", "length": 250, "header": "tr|A0A0G2QC52-1|A0A0G2QC52_RAT Isoform 1 of RAB, member of RAS oncogene family like 2 OS=Rattus norvegicus OX=10116 GN=Rabl2 PE=1 SV=1 CANONICAL=A0A0G2QC52-1" }, "locus": { "chromosome": "7", "start_pos": 120660525, "end_pos": 120652974, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000044262.6", "url": "https://www.ensembl.org/id/ENSRNOT00000044262.6" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000040188.5", "url": "https://www.ensembl.org/id/ENSRNOP00000040188.5" } ] } }, { "isoform_ac": "A0A8I6G533-1", "url": "", "sequence": { "sequence": "MAGDRSKQGELDQEKYDAHENVKIICLGDSAVGKSKYLMSRGKSPIRTWAPADIQMTQKNFSFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVAYKKSSQDFMDEVLQELENFKLEQKEEDTPDQEQGDMSKSPSPS", "length": 138, "header": "tr|A0A8I6G533-1|A0A8I6G533_RAT Computationally mapped isoform of RAB, member of RAS oncogene family like 2 OS=Rattus norvegicus OX=10116 GN=Rabl2 PE=1 SV=1 CANONICAL=A0A0G2QC52-1" }, "locus": { "chromosome": "7", "start_pos": 120659862, "end_pos": 120652974, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000094124.1", "url": "https://www.ensembl.org/id/ENSRNOT00000094124.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000079277.1", "url": "https://www.ensembl.org/id/ENSRNOP00000079277.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "E9Q9D5-2", "protein_name": "Rab-like protein 2A", "gene_name": "Rabl2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAGDRNRHCELEQEKYDTHENVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKITYKNLGTWYAELREFRPEIPCILVANKIDADIQMTQKNFSFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVAYKESSQDFMDEVLQELENFKLEQKEEDTSGQEQSDTTKSPSPS", "length": 223 }, "evidence": [ { "id": "45236687", "url": "http://www.informatics.jax.org/homology/45236687", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UBK7-1", "protein_name": "Rab-like protein 2A", "gene_name": "RABL2A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDIQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDDINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEVASPHS", "length": 228 }, "evidence": [ { "id": "45236687", "url": "http://www.informatics.jax.org/homology/45236687", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9UNT1-1", "protein_name": "Rab-like protein 2B", "gene_name": "RABL2B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDDINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS", "length": 228 }, "evidence": [ { "id": "45236687", "url": "http://www.informatics.jax.org/homology/45236687", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" }, { "name": "endomembrane system", "id": "GO:0012505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012505", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" }, { "name": "centriole", "id": "GO:0005814", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005814", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" }, { "name": "ciliary basal body", "id": "GO:0036064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036064", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" }, { "name": "sperm midpiece", "id": "GO:0097225", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097225", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" }, { "name": "pericentriolar material", "id": "GO:0000242", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000242", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" }, { "name": "intraciliary transport particle B", "id": "GO:0030992", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030992", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "intracellular protein transport", "id": "GO:0006886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006886", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" }, { "name": "flagellated sperm motility", "id": "GO:0030317", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030317", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" }, { "name": "single fertilization", "id": "GO:0007338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007338", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" }, { "name": "cilium assembly", "id": "GO:0060271", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060271", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" }, { "name": "intraciliary transport", "id": "GO:0042073", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042073", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" }, { "name": "photoreceptor cell morphogenesis", "id": "GO:0008594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008594", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC52", "url": "https://www.uniprot.org/uniprot/A0A0G2QC52" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 172, "end_pos": 174, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }