{ "uniprot_canonical_ac": "A0A0G2QC40-1", "uniprot_ac": "A0A0G2QC40", "uniprot_id": "A0A0G2QC40_RAT", "mass": { "chemical_mass": 53088.0, "monoisotopic_mass": 53088.0 }, "refseq": {}, "gene_names": [ { "name": "Mkrn1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40", "id": "A0A0G2QC40" } ], "protein_names": [ { "name": "RING-type E3 ubiquitin transferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0G2QC40" }, { "name": "2.3.2.27", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2QC40" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC40", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40" } ], "common_name": "Rat" } ], "gene": [ { "name": "Mkrn1", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40", "locus": { "chromosome": "4", "start_pos": 68175909, "end_pos": 68197165, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000009280", "url": "https://www.ensembl.org/id/ENSRNOG00000009280" } ] } } ], "crossref": [ { "id": "ENSRNOG00000009280", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000009280", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd16730", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16730", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "296988", "url": "https://www.ncbi.nlm.nih.gov/gene/296988", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000571", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000571", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001841", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017907", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017907", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018957", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018957", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031644", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031644", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036855", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036855", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041367", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041367", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "QQTNVEM", "url": "https://omabrowser.org/oma/group/QQTNVEM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2906101at2759", "url": "http://www.orthodb.org/?query=2906101at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11224", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11224", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11224:SF37", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11224:SF37", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00097", "url": "http://pfam.xfam.org/family/PF00097", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF14608", "url": "http://pfam.xfam.org/family/PF14608", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF15815", "url": "http://pfam.xfam.org/family/PF15815", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18044", "url": "http://pfam.xfam.org/family/PF18044", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-198323", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-198323", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8948751", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8948751", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983168", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_006236363", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006236363", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1303251", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1303251", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2QC40", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2QC40-1", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ALB9", "url": "https://www.uniprot.org/uniprot/A0A8I6ALB9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ALB9-1", "url": "https://www.uniprot.org/uniprot/A0A8I6ALB9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAEAAAPGTTATTSGAGAAAAAVAAASLTSIPTVAAPSPGAGGGGGGSDGSGGGWTKQVTCRYFMHGVCKEGDNCRYSHDLSDSPYGVVCKYFQRGYCVYGDRCRYEHSKPLKQEEVTATDLSAKPSPAASSSLPSGVGSLAEMNPGEAESRNPNFPTVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEVPLQGSVTKEESEKEPTTVETEKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPMDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLIQKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRSHFWELIEERENNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLFHDELEDFYDLEL", "length": 481, "header": "tr|A0A0G2QC40-1|A0A0G2QC40_RAT Isoform 1 of RING-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Mkrn1 PE=4 SV=1 CANONICAL=A0A0G2QC40-1" }, "isoforms": [ { "isoform_ac": "A0A0G2QC40-1", "url": "", "sequence": { "sequence": "MAEAAAPGTTATTSGAGAAAAAVAAASLTSIPTVAAPSPGAGGGGGGSDGSGGGWTKQVTCRYFMHGVCKEGDNCRYSHDLSDSPYGVVCKYFQRGYCVYGDRCRYEHSKPLKQEEVTATDLSAKPSPAASSSLPSGVGSLAEMNPGEAESRNPNFPTVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEVPLQGSVTKEESEKEPTTVETEKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPMDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLIQKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRSHFWELIEERENNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLFHDELEDFYDLEL", "length": 481, "header": "tr|A0A0G2QC40-1|A0A0G2QC40_RAT Isoform 1 of RING-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Mkrn1 PE=4 SV=1 CANONICAL=A0A0G2QC40-1" }, "locus": { "chromosome": "4", "start_pos": 68197021, "end_pos": 68177354, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000013124.6", "url": "https://www.ensembl.org/id/ENSRNOT00000013124.6" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000013124.4", "url": "https://www.ensembl.org/id/ENSRNOP00000013124.4" } ] } }, { "isoform_ac": "A0A8I6ALB9-1", "url": "", "sequence": { "sequence": "MAEAAAPGTTATTSGAGAAAAAVAAASLTSIPTVAAPSPGAGGGGGGSDGSGGGWTKQVTCRYEHSKPLKQEEVTATDLSAKPSPAASSSLPSGVGSLAEMNPGEAESRNPNFPTVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEVPLQGSVTKEESEKEPTTVETEKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPMDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLIQKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRRSHFWELIEERENNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLFHDELEDFYDLEL", "length": 435, "header": "tr|A0A8I6ALB9-1|A0A0G2QC40_RAT Computationally mapped isoform of RING-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Mkrn1 PE=4 SV=1 CANONICAL=A0A0G2QC40-1" }, "locus": { "chromosome": "4", "start_pos": 68197021, "end_pos": 68177354, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000110014.1", "url": "https://www.ensembl.org/id/ENSRNOT00000110014.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000089576.1", "url": "https://www.ensembl.org/id/ENSRNOP00000089576.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "R-RNO-198323", "name": "AKT phosphorylates targets in the cytosol", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-198323", "resource": "Reactome", "description": "AKT phosphorylates targets in the cytosol" }, { "id": "R-RNO-8948751", "name": "Regulation of PTEN stability and activity", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8948751", "resource": "Reactome", "description": "Regulation of PTEN stability and activity" }, { "id": "R-RNO-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983168", "resource": "Reactome", "description": "Antigen processing: Ubiquitination & Proteasome degradation" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9QXP6-1", "protein_name": "E3 ubiquitin-protein ligase makorin-1", "gene_name": "Mkrn1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAEAAAPGTTATTSGAGAAAAAVAAASLTSIPTVAAPSPGAGGGGGGSDGSGGGWTKQVTCRYFMHGVCKEGDNCRYSHDLSDSPYGVVCKYFQRGYCVYGDRCRYEHSKPLKQEEVTATDLSAKPSLAASSSLSSGVGSLAEMNSGEAESRNPSFPTVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEVPPQGSVTKEESEKEPTTVETKKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPVDAAQRSQHIKSCIEAHEKDMELSFAVQRTKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLIQKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRSHFWELIEERENNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLFHDELEDFYDLDL", "length": 481 }, "evidence": [ { "id": "45224901", "url": "http://www.informatics.jax.org/homology/45224901", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UHC7-1", "protein_name": "E3 ubiquitin-protein ligase makorin-1", "gene_name": "MKRN1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAEAATPGTTATTSGAGAAAATAAAASPTPIPTVTAPSLGAGGGGGGSDGSGGGWTKQVTCRYFMHGVCKEGDNCRYSHDLSDSPYSVVCKYFQRGYCIYGDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAESRNSNFATVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEAPLQGSVTKEESEKEQTAVETKKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPMDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLILKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFWELIEERENSNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLFHDELEDFYDLDL", "length": 482 }, "evidence": [ { "id": "45224901", "url": "http://www.informatics.jax.org/homology/45224901", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC40", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC40", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40" } ], "pmid": "" }, { "name": "ubiquitin protein ligase activity", "id": "GO:0061630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC40", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "cellular response to leukemia inhibitory factor", "id": "GO:1990830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990830", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC40", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40" } ], "pmid": "" }, { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC40", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40" } ], "pmid": "" }, { "name": "protein polyubiquitination", "id": "GO:0000209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000209", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC40", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 306, "end_pos": 308, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-RNO-8948757", "name": "AKT phosphorylates MKRN1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-RNO-976042" ], "output_participant_list": [ "R-RNO-8948758" ], "enzyme_list": [ "P47196-1", "P47197-1", "Q63484-1", "A0A0G2QC40-1" ], "evidence": [ { "id": "R-RNO-8948757", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8948757" } ] }, { "id": "R-RNO-8948775", "name": "MKRN1 polyubiquitinates PTEN", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-RNO-8948777" ], "enzyme_list": [ "O54857-1", "A0A0G2QC40-1" ], "evidence": [ { "id": "R-RNO-8948775", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8948775" } ] }, { "id": "R-RNO-983140", "name": "Transfer of Ub from E2 to substrate and release of E2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6AYH3-1", "F1LP64-1", "Q5BK82-1", "Q91ZY8-1", "O88846-1", "Q9JK66-1", "Q62921-1", "D3ZXK7-1", "Q2TL32-1", "Q8K4S7-1", "Q62940-1", "P63149-1", "B2GV24-1", "P61078-1", "Q3T1H6-1", "Q6P7A2-1", "Q71F54-1", "Q8R4T2-1", "A0A0G2JUC9-1", "A0A0G2K612-1", "D3ZHB7-1", "A0A8I5YBG5-1", "G3V930-1", "D3ZJB8-1", "D3ZLS5-1", "D3ZXM0-1", "D4ABK2-1", "D4ADD3-1", "D3ZDI6-1", "Q5PQN1-1", "D3Z8X6-1", "D4ACF2-1", "A0A0G2K9T1-1", "D4A1V8-1", "F1M9Q3-1", "Q66H79-1", "Q920M9-1", "B1H278-1", "B5DFI8-1", "P62839-1", "Q4V8J2-1", "Q63364-1", "Q6MFZ5-1", "Q810I1-1", "Q91Z63-1", "D3ZBM4-1", "D3ZDK2-1", "P62255-1", "Q3B7D1-1", "Q5U203-1", "Q6J2U6-1", "Q99PD2-1", "Q9EQX9-1", "D3ZVM4-1", "D3ZBM7-1", "Q5XIQ4-1", "Q68LP1-1", "Q6Y290-1", "F1M3F2-1", "A0A0G2K0E7-1", "A0A0G2QC40-1", "D3ZFK0-1", "A0A0G2K6H9-1", "A0A0G2K735-1", "A0A8I5ZZN6-1", "D3ZS02-1", "F1M7B8-1" ], "evidence": [ { "id": "R-RNO-983140", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983140" } ] }, { "id": "R-RNO-983147", "name": "Release of E3 from polyubiquitinated substrate", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6AYH3-1", "F1LP64-1", "Q5BK82-1", "Q91ZY8-1", "O88846-1", "Q9JK66-1", "Q62921-1", "D3ZXK7-1", "Q2TL32-1", "Q8K4S7-1", "Q62940-1", "B2GV24-1", "Q3T1H6-1", "Q6P7A2-1", "Q71F54-1", "Q8R4T2-1", "A0A0G2JUC9-1", "A0A0G2K612-1", "D3ZHB7-1", "A0A8I5YBG5-1", "G3V930-1", "D3ZJB8-1", "D3ZLS5-1", "D3ZXM0-1", "D4ABK2-1", "D4ADD3-1", "D3ZDI6-1", "Q5PQN1-1", "D3Z8X6-1", "D4ACF2-1", "A0A0G2K9T1-1", "D4A1V8-1", "F1M9Q3-1", "Q66H79-1", "Q920M9-1", "B1H278-1", "Q63364-1", "Q6MFZ5-1", "Q810I1-1", "Q91Z63-1", "D3ZBM4-1", "Q6J2U6-1", "Q99PD2-1", "D3ZVM4-1", "D3ZBM7-1", "Q5XIQ4-1", "Q68LP1-1", "Q6Y290-1", "F1M3F2-1", "A0A0G2K0E7-1", "A0A0G2QC40-1", "D3ZFK0-1", "A0A0G2K6H9-1", "A0A8I5ZZN6-1", "D3ZS02-1", "F1M7B8-1" ], "evidence": [ { "id": "R-RNO-983147", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983147" } ] }, { "id": "R-RNO-983156", "name": "Polyubiquitination of substrate", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6AYH3-1", "F1LP64-1", "Q5BK82-1", "Q91ZY8-1", "O88846-1", "Q9JK66-1", "Q62921-1", "D3ZXK7-1", "Q2TL32-1", "Q8K4S7-1", "Q62940-1", "P63149-1", "B2GV24-1", "P61078-1", "Q3T1H6-1", "Q6P7A2-1", "Q71F54-1", "Q8R4T2-1", "A0A0G2JUC9-1", "A0A0G2K612-1", "D3ZHB7-1", "A0A8I5YBG5-1", "G3V930-1", "D3ZJB8-1", "D3ZLS5-1", "D3ZXM0-1", "D4ABK2-1", "D4ADD3-1", "D3ZDI6-1", "Q5PQN1-1", "D3Z8X6-1", "D4ACF2-1", "A0A0G2K9T1-1", "D4A1V8-1", "F1M9Q3-1", "Q66H79-1", "Q920M9-1", "B1H278-1", "B5DFI8-1", "P62839-1", "Q4V8J2-1", "Q63364-1", "Q6MFZ5-1", "Q810I1-1", "Q91Z63-1", "D3ZBM4-1", "D3ZDK2-1", "P62255-1", "Q3B7D1-1", "Q5U203-1", "Q6J2U6-1", "Q99PD2-1", "Q9EQX9-1", "D3ZVM4-1", "D3ZBM7-1", "Q5XIQ4-1", "Q68LP1-1", "Q6Y290-1", "F1M3F2-1", "A0A0G2K0E7-1", "A0A0G2QC40-1", "D3ZFK0-1", "A0A0G2K6H9-1", "A0A0G2K735-1", "A0A8I5ZZN6-1", "D3ZS02-1", "F1M7B8-1" ], "evidence": [ { "id": "R-RNO-983156", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983156" } ] }, { "id": "R-RNO-983157", "name": "Interaction of E3 with substrate and E2-Ub complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6AYH3-1", "F1LP64-1", "Q5BK82-1", "Q91ZY8-1", "O88846-1", "Q9JK66-1", "Q62921-1", "D3ZXK7-1", "Q2TL32-1", "Q8K4S7-1", "Q62940-1", "P63149-1", "B2GV24-1", "P61078-1", "Q3T1H6-1", "Q6P7A2-1", "Q71F54-1", "Q8R4T2-1", "A0A0G2JUC9-1", "A0A0G2K612-1", "D3ZHB7-1", "A0A8I5YBG5-1", "G3V930-1", "D3ZJB8-1", "D3ZLS5-1", "D3ZXM0-1", "D4ABK2-1", "D4ADD3-1", "D3ZDI6-1", "Q5PQN1-1", "D3Z8X6-1", "D4ACF2-1", "A0A0G2K9T1-1", "D4A1V8-1", "F1M9Q3-1", "Q66H79-1", "Q920M9-1", "B1H278-1", "B5DFI8-1", "P62839-1", "Q4V8J2-1", "Q63364-1", "Q6MFZ5-1", "Q810I1-1", "Q91Z63-1", "D3ZBM4-1", "D3ZDK2-1", "P62255-1", "Q3B7D1-1", "Q5U203-1", "Q6J2U6-1", "Q99PD2-1", "Q9EQX9-1", "D3ZVM4-1", "D3ZBM7-1", "Q5XIQ4-1", "Q68LP1-1", "Q6Y290-1", "F1M3F2-1", "A0A0G2K0E7-1", "A0A0G2QC40-1", "D3ZFK0-1", "A0A0G2K6H9-1", "A0A0G2K735-1", "A0A8I5ZZN6-1", "D3ZS02-1", "F1M7B8-1" ], "evidence": [ { "id": "R-RNO-983157", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-983157" } ] } ], "reaction_participants": [ { "participant_id": "R-RNO-8948758", "participant_name": "phospho-Mkrn1 [cytosol]", "crossref": [ { "id": "A0A0G2QC40", "database": "UniProt", "url": "" }, { "id": "ENSRNOG00000009280", "database": "Ensembl", "url": "" }, { "id": "ENSRNOT00000013124", "database": "Ensembl", "url": "" }, { "id": "ENSRNOP00000013124", "database": "Ensembl", "url": "" }, { "id": "1303251", "database": "RGD", "url": "" }, { "id": "XP_006236363.1", "database": "RefSeq", "url": "" } ] }, { "participant_id": "R-RNO-8948777", "participant_name": "Pten [cytosol]", "crossref": [ { "id": "O54857", "database": "UniProt", "url": "" }, { "id": "NP_113794.1", "database": "RefSeq", "url": "" }, { "id": "ENSRNOG00000020723", "database": "Ensembl", "url": "" }, { "id": "ENSRNOT00000028143", "database": "Ensembl", "url": "" }, { "id": "3.1.3.16", "database": "IntEnz", "url": "" }, { "id": "ENSRNOP00000028143", "database": "Ensembl", "url": "" }, { "id": "2K20", "database": "PDB", "url": "" }, { "id": "61995", "database": "RGD", "url": "" } ] }, { "participant_id": "R-RNO-976042", "participant_name": "Mkrn1 [cytosol]", "crossref": [ { "id": "ENSRNOG00000009280", "database": "Ensembl", "url": "" }, { "id": "ENSRNOP00000013124", "database": "Ensembl", "url": "" }, { "id": "XP_006236363.1", "database": "RefSeq", "url": "" }, { "id": "ENSRNOT00000013124", "database": "Ensembl", "url": "" }, { "id": "A0A0G2QC40", "database": "UniProt", "url": "" }, { "id": "1303251", "database": "RGD", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JUC9", "gene_name": "Herc2", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A0G2JUC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JUC9" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "A0A0G2JUC9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JUC9" } ] } ] }, { "uniprot_ac": "A0A0G2K0E7", "gene_name": "Ube3b", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A0G2K0E7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K0E7" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "A0A0G2K0E7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K0E7" } ] } ] }, { "uniprot_ac": "A0A0G2K612", "gene_name": "Smurf1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A0G2K612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K612" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "A0A0G2K612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K612" } ] } ] }, { "uniprot_ac": "A0A0G2K6H9", "gene_name": "Rnf19b", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "A0A0G2K6H9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K6H9" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "A0A0G2K6H9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K6H9" } ] } ] }, { "uniprot_ac": "A0A0G2K735", "gene_name": "Uba7", "activity": [ { "ec_number": "6.2.1.45", "activity": "ATP + ubiquitin + [E1 ubiquitin-activating enzyme]-L-cysteine = AMP + diphosphate + S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine.", "evidence": [ { "id": "A0A0G2K735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K735" } ] }, { "ec_number": "6.2.1.45", "activity": "", "evidence": [ { "id": "A0A0G2K735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K735" } ] } ] }, { "uniprot_ac": "A0A0G2K9T1", "gene_name": "Itch", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A0G2K9T1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K9T1" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "A0A0G2K9T1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K9T1" } ] } ] }, { "uniprot_ac": "A0A0G2QC40", "gene_name": "Mkrn1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A0G2QC40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "A0A0G2QC40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2QC40" } ] } ] }, { "uniprot_ac": "A0A8I5YBG5", "gene_name": "Ubr2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A8I5YBG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5YBG5" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "A0A8I5YBG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5YBG5" } ] } ] }, { "uniprot_ac": "A0A8I5ZZN6", "gene_name": "Ubr1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A8I5ZZN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZZN6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "A0A8I5ZZN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZZN6" } ] } ] }, { "uniprot_ac": "B1H278", "gene_name": "Trim11", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "B1H278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1H278" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "B1H278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1H278" } ] } ] }, { "uniprot_ac": "B2GV24", "gene_name": "Ufl1", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "B2GV24", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GV24" } ] } ] }, { "uniprot_ac": "B5DFI8", "gene_name": "Ube2s", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "B5DFI8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B5DFI8" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "B5DFI8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B5DFI8" } ] } ] }, { "uniprot_ac": "D3Z8X6", "gene_name": "Dtx3l", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3Z8X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8X6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D3Z8X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8X6" } ] } ] }, { "uniprot_ac": "D3ZBM4", "gene_name": "Rnf182", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZBM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZBM4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D3ZBM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZBM4" } ] } ] }, { "uniprot_ac": "D3ZBM7", "gene_name": "Hace1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZBM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZBM7" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "D3ZBM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZBM7" } ] } ] }, { "uniprot_ac": "D3ZDI6", "gene_name": "Mylip", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZDI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDI6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D3ZDI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDI6" } ] } ] }, { "uniprot_ac": "D3ZDK2", "gene_name": "Ube2d1", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZDK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDK2" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "D3ZDK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDK2" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "D3ZDK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDK2" } ] } ] }, { "uniprot_ac": "D3ZFK0", "gene_name": "Rnf144b", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "D3ZFK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZFK0" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "D3ZFK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZFK0" } ] } ] }, { "uniprot_ac": "D3ZHB7", "gene_name": "Ube3c", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZHB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZHB7" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "D3ZHB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZHB7" } ] } ] }, { "uniprot_ac": "D3ZJB8", "gene_name": "Arih2", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "D3ZJB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZJB8" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "D3ZJB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZJB8" } ] } ] }, { "uniprot_ac": "D3ZLS5", "gene_name": "Hectd1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZLS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZLS5" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "D3ZLS5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZLS5" } ] } ] }, { "uniprot_ac": "D3ZS02", "gene_name": "Cbll1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZS02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZS02" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D3ZS02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZS02" } ] } ] }, { "uniprot_ac": "D3ZVM4", "gene_name": "Trim71", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZVM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZVM4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D3ZVM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZVM4" } ] } ] }, { "uniprot_ac": "D3ZXK7", "gene_name": "Rnf123", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D3ZXK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZXK7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D3ZXK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZXK7" } ] } ] }, { "uniprot_ac": "D3ZXM0", "gene_name": "Rnf19a", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "D3ZXM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZXM0" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "D3ZXM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZXM0" } ] } ] }, { "uniprot_ac": "D4A1V8", "gene_name": "Dzip3", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D4A1V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A1V8" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D4A1V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A1V8" } ] } ] }, { "uniprot_ac": "D4ABK2", "gene_name": "Rnf217", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "D4ABK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ABK2" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "D4ABK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ABK2" } ] } ] }, { "uniprot_ac": "D4ACF2", "gene_name": "Trim21", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D4ACF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACF2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "D4ACF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ACF2" } ] } ] }, { "uniprot_ac": "D4ADD3", "gene_name": "Hecw2", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "D4ADD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADD3" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "D4ADD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADD3" } ] } ] }, { "uniprot_ac": "F1LP64", "gene_name": "Trip12", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "F1LP64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LP64" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "F1LP64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LP64" } ] } ] }, { "uniprot_ac": "F1M3F2", "gene_name": "Smurf2", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "F1M3F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3F2" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "F1M3F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3F2" } ] } ] }, { "uniprot_ac": "F1M7B8", "gene_name": "Ube3a", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "F1M7B8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M7B8" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "F1M7B8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M7B8" } ] } ] }, { "uniprot_ac": "F1M9Q3", "gene_name": "Ltn1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "F1M9Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M9Q3" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "F1M9Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M9Q3" } ] } ] }, { "uniprot_ac": "G3V930", "gene_name": "Rnf41", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "G3V930", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V930" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "G3V930", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V930" } ] } ] }, { "uniprot_ac": "O54857", "gene_name": "Pten", "activity": [ { "ec_number": "3.1.3.67", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + phosphate.", "evidence": [ { "id": "O54857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54857" } ] }, { "ec_number": "3.1.3.16", "activity": "H2O + O-phospho-L-threonyl-[protein] = L-threonyl-[protein] + phosphate.", "evidence": [ { "id": "O54857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54857" } ] }, { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "O54857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54857" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O54857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54857" } ] }, { "ec_number": "3.1.3.67", "activity": "", "evidence": [ { "id": "O54857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54857" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "O54857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54857" } ] } ] }, { "uniprot_ac": "O88846", "gene_name": "Rnf4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O88846", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88846" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O88846", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88846" } ] } ] }, { "uniprot_ac": "P47196", "gene_name": "Akt1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P47196", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47196" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P47196", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47196" } ] } ] }, { "uniprot_ac": "P47197", "gene_name": "Akt2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P47197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47197" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P47197", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47197" } ] } ] }, { "uniprot_ac": "P61078", "gene_name": "Ube2d3", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P61078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61078" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P61078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61078" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P61078", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61078" } ] } ] }, { "uniprot_ac": "P62255", "gene_name": "Ube2g1", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P62255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62255" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P62255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62255" } ] } ] }, { "uniprot_ac": "P62839", "gene_name": "Ube2d2", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P62839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62839" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P62839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62839" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P62839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62839" } ] } ] }, { "uniprot_ac": "P63149", "gene_name": "Ube2b", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P63149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63149" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P63149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63149" } ] } ] }, { "uniprot_ac": "Q2TL32", "gene_name": "Ubr4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q2TL32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TL32" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q2TL32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TL32" } ] } ] }, { "uniprot_ac": "Q3B7D1", "gene_name": "Ube2z", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q3B7D1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3B7D1" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q3B7D1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3B7D1" } ] } ] }, { "uniprot_ac": "Q3T1H6", "gene_name": "Ube3d", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q3T1H6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3T1H6" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q3T1H6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3T1H6" } ] } ] }, { "uniprot_ac": "Q4V8J2", "gene_name": "Ube2l6", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q4V8J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8J2" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q4V8J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8J2" } ] } ] }, { "uniprot_ac": "Q5BK82", "gene_name": "Trim69", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5BK82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK82" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q5BK82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK82" } ] } ] }, { "uniprot_ac": "Q5PQN1", "gene_name": "Herc4", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5PQN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5PQN1" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q5PQN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5PQN1" } ] } ] }, { "uniprot_ac": "Q5U203", "gene_name": "Ube2f", "activity": [ { "ec_number": "2.3.2.32", "activity": "S-[NEDD8-protein]-yl-[E2 NEDD8-conjugating enzyme]-L-cysteine + [cullin]-L-lysine = [E2 NEDD8-conjugating enzyme]-L-cysteine + N(6)-[NEDD8-protein]-yl-[cullin]-L-lysine.", "evidence": [ { "id": "Q5U203", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U203" } ] }, { "ec_number": "2.3.2.32", "activity": "", "evidence": [ { "id": "Q5U203", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U203" } ] } ] }, { "uniprot_ac": "Q5XIQ4", "gene_name": "Mgrn1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5XIQ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIQ4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q5XIQ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIQ4" } ] } ] }, { "uniprot_ac": "Q62921", "gene_name": "Rbck1", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q62921", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62921" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q62921", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62921" } ] } ] }, { "uniprot_ac": "Q62940", "gene_name": "Nedd4", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q62940", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62940" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q62940", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62940" } ] } ] }, { "uniprot_ac": "Q63364", "gene_name": "Pja2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q63364", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63364" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q63364", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63364" } ] } ] }, { "uniprot_ac": "Q63484", "gene_name": "Akt3", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63484", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63484" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q63484", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63484" } ] } ] }, { "uniprot_ac": "Q66H79", "gene_name": "Trim32", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q66H79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H79" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q66H79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H79" } ] } ] }, { "uniprot_ac": "Q68LP1", "gene_name": "Mib2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q68LP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68LP1" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q68LP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68LP1" } ] } ] }, { "uniprot_ac": "Q6AYH3", "gene_name": "Rnf34", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6AYH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYH3" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6AYH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYH3" } ] } ] }, { "uniprot_ac": "Q6J2U6", "gene_name": "Rnf114", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6J2U6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6J2U6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6J2U6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6J2U6" } ] } ] }, { "uniprot_ac": "Q6MFZ5", "gene_name": "Trim39", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6MFZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6MFZ5" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6MFZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6MFZ5" } ] } ] }, { "uniprot_ac": "Q6P7A2", "gene_name": "Ube4a", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6P7A2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7A2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6P7A2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P7A2" } ] } ] }, { "uniprot_ac": "Q6Y290", "gene_name": "Rnf130", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6Y290", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6Y290" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6Y290", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6Y290" } ] } ] }, { "uniprot_ac": "Q71F54", "gene_name": "Sh3rf1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q71F54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q71F54" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q71F54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q71F54" } ] } ] }, { "uniprot_ac": "Q810I1", "gene_name": "Trim50", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q810I1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810I1" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q810I1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810I1" } ] } ] }, { "uniprot_ac": "Q8K4S7", "gene_name": "Cblb", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8K4S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4S7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8K4S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4S7" } ] } ] }, { "uniprot_ac": "Q8R4T2", "gene_name": "Siah2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8R4T2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4T2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8R4T2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4T2" } ] } ] }, { "uniprot_ac": "Q91Z63", "gene_name": "Trim63", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q91Z63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z63" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q91Z63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z63" } ] } ] }, { "uniprot_ac": "Q91ZY8", "gene_name": "Trim9", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q91ZY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZY8" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q91ZY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZY8" } ] } ] }, { "uniprot_ac": "Q920M9", "gene_name": "Siah1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q920M9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920M9" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q920M9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920M9" } ] } ] }, { "uniprot_ac": "Q99PD2", "gene_name": "Rnf138", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q99PD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PD2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q99PD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PD2" } ] } ] }, { "uniprot_ac": "Q9EQX9", "gene_name": "Ube2n", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q9EQX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQX9" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q9EQX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQX9" } ] } ] }, { "uniprot_ac": "Q9JK66", "gene_name": "Prkn", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q9JK66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JK66" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q9JK66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JK66" } ] }, { "ec_number": "6.3.2.19", "activity": "", "evidence": [ { "id": "Q9JK66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JK66" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }