{ "uniprot_canonical_ac": "A0A0G2QC33-1", "uniprot_ac": "A0A0G2QC33", "uniprot_id": "ATG4B_RAT", "mass": { "chemical_mass": 44364.0, "monoisotopic_mass": 44364.0 }, "refseq": { "ac": "XP_006245596", "name": "cysteine protease ATG4B isoform X2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006245596" }, "gene_names": [ { "name": "Atg4b", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33", "id": "A0A0G2QC33" }, { "name": "Apg4b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006245596", "id": "XP_006245596" }, { "name": "Atg4b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006245596", "id": "XP_006245596" } ], "protein_names": [ { "name": "Cysteine protease ATG4B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0G2QC33" }, { "name": "3.4.22.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2QC33" }, { "name": "Autophagy-related protein 4 homolog B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2QC33" }, { "name": "cysteine protease ATG4B isoform X2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006245596", "id": "XP_006245596" } ], "function": [ { "annotation": "Cysteine protease that plays a key role in autophagy by mediating both proteolytic activation and delipidation of ATG8 family proteins.", "evidence": [ { "database": "UniProtKB", "id": "A0A8I6GGT0", "url": "https://www.uniprot.org/uniprot/A0A8I6GGT0#function" }, { "database": "UniProtKB", "id": "RU363115", "url": "https://www.uniprot.org/uniprot/RU363115#function" }, { "database": "UniProtKB", "id": "A0A8I5ZQY4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZQY4#function" }, { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33#function" }, { "database": "UniProtKB", "id": "Q9Y4P1", "url": "https://www.uniprot.org/uniprot/Q9Y4P1#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "common_name": "Rat" } ], "gene": [ { "name": "Atg4b", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33", "locus": { "chromosome": "9", "start_pos": 94314103, "end_pos": 94282509, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000018403", "url": "https://www.ensembl.org/id/ENSRNOG00000018403" } ] } } ], "crossref": [ { "id": "ENSRNOG00000018403", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000018403", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "316640", "url": "https://www.ncbi.nlm.nih.gov/gene/316640", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR005078", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005078", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038765", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038765", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046792", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046792", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046793", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046793", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:316640", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:316640", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CHTRRIR", "url": "https://omabrowser.org/oma/group/CHTRRIR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "276806at2759", "url": "http://www.orthodb.org/?query=276806at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22624", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22624", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22624:SF39", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22624:SF39", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03416", "url": "http://pfam.xfam.org/family/PF03416", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF20166", "url": "http://pfam.xfam.org/family/PF20166", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A0G2QC33", "url": "http://purl.obolibrary.org/obo/PR_A0A0G2QC33", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-1632852", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1632852", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001020882", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001020882", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1309664", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1309664", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "67548", "url": "https://www.rhea-db.org/rhea/67548", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "67576", "url": "https://www.rhea-db.org/rhea/67576", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2QC33-1", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2QC33-2", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZQY4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZQY4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZQY4-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZQY4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GGT0", "url": "https://www.uniprot.org/uniprot/A0A8I6GGT0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GGT0-1", "url": "https://www.uniprot.org/uniprot/A0A8I6GGT0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRRNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFLDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRASLPCAGAAALSMESERHCNGLPAGAEVTNRPLAWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVELTDSCFIPDESFHCQHPPCRMGIGELDPSIAVGFFCKTEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQDVLNLSLDSSDVERLERFFDSEDEDFEILSL", "length": 393, "header": "sp|A0A0G2QC33-1|ATG4B_RAT Isoform 1 of Cysteine protease ATG4B OS=Rattus norvegicus OX=10116 GN=Atg4b PE=1 SV=1 CANONICAL=A0A0G2QC33-1" }, "isoforms": [ { "isoform_ac": "A0A0G2QC33-1", "url": "", "sequence": { "sequence": "MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRRNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFLDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRASLPCAGAAALSMESERHCNGLPAGAEVTNRPLAWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVELTDSCFIPDESFHCQHPPCRMGIGELDPSIAVGFFCKTEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQDVLNLSLDSSDVERLERFFDSEDEDFEILSL", "length": 393, "header": "sp|A0A0G2QC33-1|ATG4B_RAT Isoform 1 of Cysteine protease ATG4B OS=Rattus norvegicus OX=10116 GN=Atg4b PE=1 SV=1 CANONICAL=A0A0G2QC33-1" }, "locus": { "chromosome": "9", "start_pos": 94312423, "end_pos": 94282561, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000025529", "url": "https://www.ensembl.org/id/ENSRNOT00000025529" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000025529", "url": "https://www.ensembl.org/id/ENSRNOP00000025529" } ] } }, { "isoform_ac": "A0A0G2QC33-2", "url": "", "sequence": { "sequence": "MDNTVVMEEIRRLCRASLPCAGAAALSMESERHCNGLPAGAEVTNRPLAWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVELTDSCFIPDESFHCQHPPCRMGIGELDPSIAVGFFCKTEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQDVLNLSLDSSDVERLERFFDSEDEDFEILSL", "length": 224, "header": "sp|A0A0G2QC33-2|ATG4B_RAT Isoform 2 of Cysteine protease ATG4B OS=Rattus norvegicus OX=10116 GN=Atg4b PE=1 SV=1 CANONICAL=A0A0G2QC33-1" }, "locus": {} }, { "isoform_ac": "A0A8I5ZQY4-1", "url": "", "sequence": { "sequence": "MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRRNFPAIDWRWTQRKRQPDSYFSVLNAFLDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRASLPCAGAAALSMESERHCNGLPAGAEVTNRPLAWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVELTDSCFIPDESFHCQHPPCRMGIGELDPSIAVGFFCKTEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQDVLNLSLDSSDVERLERFFDSEDEDFEILSL", "length": 360, "header": "tr|A0A8I5ZQY4-1|ATG4B_RAT Computationally mapped isoform of Cysteine protease ATG4B OS=Rattus norvegicus OX=10116 GN=Atg4b PE=1 SV=1 CANONICAL=A0A0G2QC33-1" }, "locus": { "chromosome": "9", "start_pos": 94312423, "end_pos": 94282561, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000116331.1", "url": "https://www.ensembl.org/id/ENSRNOT00000116331.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000079449.1", "url": "https://www.ensembl.org/id/ENSRNOP00000079449.1" } ] } }, { "isoform_ac": "A0A8I6GGT0-1", "url": "", "sequence": { "sequence": "MVSTATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRRNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFLDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRASLPCAGAAALSMESERHCNGLPAGAEVTNRPLAWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVELTDSCFIPDESFHCQHPPCRMGIGELDPSIAVGFFCKTEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQDVLNLSLDSSDVERLERFFDSEDEDFEILSL", "length": 394, "header": "tr|A0A8I6GGT0-1|ATG4B_RAT Computationally mapped isoform of Cysteine protease ATG4B OS=Rattus norvegicus OX=10116 GN=Atg4b PE=1 SV=1 CANONICAL=A0A0G2QC33-1" }, "locus": { "chromosome": "9", "start_pos": 94312423, "end_pos": 94294690, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000102482.1", "url": "https://www.ensembl.org/id/ENSRNOT00000102482.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000088154.1", "url": "https://www.ensembl.org/id/ENSRNOP00000088154.1" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 316, "end_pos": 316, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "site_lbl": "Ser316" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "site_lbl": "Ser34" }, { "start_pos": 383, "end_pos": 383, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "site_lbl": "Ser383" }, { "start_pos": 392, "end_pos": 392, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "site_lbl": "Ser392" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Autophagy impairment mediated by S-nitrosation of ATG4B leads to neurotoxicity in response to hyperglycemia.", "journal": "Autophagy", "date": "2017", "authors": "Li Y, Zhang Y, Wang L, Wang P, Xue Y, Li X, Qiao X, Zhang X, Xu T, Liu G, Li P, Chen C", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "reference": [ { "type": "PubMed", "id": "28633005", "url": "https://glygen.org/publication/PubMed/28633005" } ] } ], "pathway": [ { "id": "rno:316640", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:316640", "resource": "KEGG Pathway" }, { "id": "R-RNO-1632852", "name": "Macroautophagy", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1632852", "resource": "Reactome", "description": "Macroautophagy" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8BGE6-1", "protein_name": "Cysteine protease ATG4B", "gene_name": "Atg4b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRRNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFNVLNAFLDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRANLPCAGAAALPTDSERHCNGFPAGAEVTNRPSAWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVELTDSCFIPDESFHCQHPPSRMGIGELDPSIAVGFFCKTEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQDVLNLSLDSSDVERLERFFDSEDEDFEILSL", "length": 393 }, "evidence": [ { "id": "45226422", "url": "http://www.informatics.jax.org/homology/45226422", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Y4P1-1", "protein_name": "Cysteine protease ATG4B", "gene_name": "ATG4B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL", "length": 393 }, "evidence": [ { "id": "45226422", "url": "http://www.informatics.jax.org/homology/45226422", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "endopeptidase activity", "id": "GO:0004175", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004175", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "scaffold protein binding", "id": "GO:0097110", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097110", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "Atg8-specific peptidase activity", "id": "GO:0019786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019786", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "peptidase activity", "id": "GO:0008233", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008233", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "cysteine-type peptidase activity", "id": "GO:0008234", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008234", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "autophagosome", "id": "GO:0005776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005776", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "protein transport", "id": "GO:0015031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015031", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "protein localization to phagophore assembly site", "id": "GO:0034497", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034497", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "mitophagy", "id": "GO:0000423", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000423", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "protein delipidation", "id": "GO:0051697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051697", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "lysosomal microautophagy", "id": "GO:0016237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016237", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "autophagy", "id": "GO:0006914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006914", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "autophagosome assembly", "id": "GO:0000045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000045", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "positive regulation of protein catabolic process", "id": "GO:0045732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045732", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "cellular response to starvation", "id": "GO:0009267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009267", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "selective autophagy", "id": "GO:0061912", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061912", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" }, { "name": "otolith mineralization completed early in development", "id": "GO:0031173", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031173", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 366, "end_pos": 368, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "S-nitrosylation in response to high glucose decreases both proteolytic activation and delipidation activities.", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2QC33", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" }, { "database": "PubMed", "id": "28633005", "url": "https://glygen.org/publication/PubMed/28633005" } ] } ], "interactions": [], "reactions": [ { "id": "67548", "name": "", "equation": "[protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "B1H274-1", "A0A8I5ZXZ8-1", "A0A0G2QC33-1", "M0R5T6-1", "Q96DT6-1", "Q86TL0-1", "Q8WYN0-1", "Q9Y4P1-1", "Q8C9S8-1", "Q8BGE6-1", "A0A0G2JFS9-1", "Q811C2-1", "Q8BGV9-1", "P53867-1", "Q54QM7-1", "Q557H7-1", "Q9VPW2-1", "Q9VF80-1" ], "evidence": [ { "id": "67548", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/67548" } ] }, { "id": "67576", "name": "", "equation": "[protein]-C-terminal L-amino acid-glycyl-phosphatidylserine + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phospho-L-serine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2QC33-1", "Q9Y4P1-1", "Q86TL0-1", "Q8BGV9-1", "Q8BGE6-1" ], "evidence": [ { "id": "67576", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/67576" } ] }, { "id": "R-RNO-5681987", "name": "LC3 is cleaved by ATG4", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2QC33-1", "B1H274-1", "A0A8I5ZXZ8-1", "M0R5T6-1" ], "evidence": [ { "id": "R-RNO-5681987", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5681987" } ] }, { "id": "R-RNO-5682377", "name": "LC3 de-lipidation by ATG4", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, phagophore assembly site membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2QC33-1", "B1H274-1", "A0A8I5ZXZ8-1", "M0R5T6-1" ], "evidence": [ { "id": "R-RNO-5682377", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5682377" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JFS9", "gene_name": "Atg4a-ps", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "A0A0G2JFS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JFS9" } ] } ] }, { "uniprot_ac": "A0A0G2QC33", "gene_name": "Atg4b", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "A0A0G2QC33", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2QC33" } ] } ] }, { "uniprot_ac": "A0A8I5ZXZ8", "gene_name": "Atg4c", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "A0A8I5ZXZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZXZ8" } ] } ] }, { "uniprot_ac": "B1H274", "gene_name": "Atg4a", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "B1H274", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1H274" } ] } ] }, { "uniprot_ac": "M0R5T6", "gene_name": "Atg4d", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "M0R5T6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0R5T6" } ] } ] }, { "uniprot_ac": "P53867", "gene_name": "ATG4", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "P53867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53867" } ] } ] }, { "uniprot_ac": "Q54QM7", "gene_name": "", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q54QM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QM7" } ] } ] }, { "uniprot_ac": "Q557H7", "gene_name": "atg4-1", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q557H7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q557H7" } ] } ] }, { "uniprot_ac": "Q811C2", "gene_name": "Atg4c", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q811C2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q811C2" } ] } ] }, { "uniprot_ac": "Q86TL0", "gene_name": "ATG4D", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q86TL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86TL0" } ] } ] }, { "uniprot_ac": "Q8BGE6", "gene_name": "Atg4b", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q8BGE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGE6" } ] } ] }, { "uniprot_ac": "Q8BGV9", "gene_name": "Atg4d", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q8BGV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGV9" } ] } ] }, { "uniprot_ac": "Q8C9S8", "gene_name": "Atg4a", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q8C9S8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C9S8" } ] } ] }, { "uniprot_ac": "Q8WYN0", "gene_name": "ATG4A", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q8WYN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WYN0" } ] } ] }, { "uniprot_ac": "Q96DT6", "gene_name": "ATG4C", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q96DT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96DT6" } ] } ] }, { "uniprot_ac": "Q9VF80", "gene_name": "Atg4b", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q9VF80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VF80" } ] } ] }, { "uniprot_ac": "Q9VPW2", "gene_name": "Atg4a", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q9VPW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VPW2" } ] } ] }, { "uniprot_ac": "Q9Y4P1", "gene_name": "ATG4B", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q9Y4P1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y4P1" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }