{ "uniprot_canonical_ac": "A0A0G2KAB7-1", "uniprot_ac": "A0A0G2KAB7", "uniprot_id": "A0A0G2KAB7_RAT", "mass": { "chemical_mass": 9978.0, "monoisotopic_mass": 9978.0 }, "refseq": {}, "gene_names": [ { "name": "Lce3e", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2KAB7", "id": "A0A0G2KAB7" }, { "name": "LOC100361951", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2KAB7", "id": "A0A0G2KAB7" } ], "protein_names": [ { "name": "Late cornified envelope 3E", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2KAB7" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAB7", "url": "https://www.uniprot.org/uniprot/A0A0G2KAB7" } ], "common_name": "Rat" } ], "gene": [ { "name": "Lce3e", "url": "https://www.uniprot.org/uniprot/A0A0G2KAB7", "locus": { "chromosome": "2", "start_pos": 178579458, "end_pos": 178579162, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000065561", "url": "https://www.ensembl.org/id/ENSRNOG00000065561" } ] } } ], "crossref": [ { "id": "ENSRNOG00000054427", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000054427", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "100361951", "url": "https://www.ncbi.nlm.nih.gov/gene/100361951", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR028205", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028205", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:100361951", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:100361951", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "KSPAQCA", "url": "https://omabrowser.org/oma/group/KSPAQCA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PF14672", "url": "http://pfam.xfam.org/family/PF14672", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_006224247", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006224247", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "2319129", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2319129", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2KAB7", "url": "https://www.uniprot.org/uniprot/A0A0G2KAB7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2KAB7-1", "url": "https://www.uniprot.org/uniprot/A0A0G2KAB7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSCQQSQKQCQPPPKCPSPKCSPKCPPKSTAQCLPAASSCCATSSGGCSVPSSEGGCCLSHHRRRSHRCRRRSSSSCDRGSGQQSGGSGCGHSSGGCC", "length": 98, "header": "tr|A0A0G2KAB7-1|A0A0G2KAB7_RAT Isoform 1 of Late cornified envelope 3E OS=Rattus norvegicus OX=10116 GN=Lce3e PE=3 SV=1 CANONICAL=A0A0G2KAB7-1" }, "isoforms": [ { "isoform_ac": "A0A0G2KAB7-1", "url": "", "sequence": { "sequence": "MSCQQSQKQCQPPPKCPSPKCSPKCPPKSTAQCLPAASSCCATSSGGCSVPSSEGGCCLSHHRRRSHRCRRRSSSSCDRGSGQQSGGSGCGHSSGGCC", "length": 98, "header": "tr|A0A0G2KAB7-1|A0A0G2KAB7_RAT Isoform 1 of Late cornified envelope 3E OS=Rattus norvegicus OX=10116 GN=Lce3e PE=3 SV=1 CANONICAL=A0A0G2KAB7-1" }, "locus": { "chromosome": "2", "start_pos": 178579455, "end_pos": 178579162, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000091537.2", "url": "https://www.ensembl.org/id/ENSRNOT00000091537.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000075337.1", "url": "https://www.ensembl.org/id/ENSRNOP00000075337.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:100361951", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:100361951", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "F8VQJ0-1", "protein_name": "Late cornified envelope 3E", "gene_name": "Lce3e", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSCQQSQKQCQPPPKCPSPKCSPKCPPKSTTQCLPAASSCCATSSGGCSLPSSEGGCCLSHHRRRSHRCRRRSSSSCDRGSGQQSGGSGCSHSSGGCC", "length": 98 }, "evidence": [ { "id": "45241892", "url": "http://www.informatics.jax.org/homology/45241892", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q497I5-1", "protein_name": "Late cornified envelope 3A", "gene_name": "Lce3a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSCQQSQKQCQPPPKCPSPKCSPKCPPKSTTQCLPAASSCCATSSGGCSVPSSEGGCCLSHHRRRSHRCRRRSSSSCDRGSGQQSGGSGCGHSSGGCC", "length": 98 }, "evidence": [ { "id": "45241888", "url": "http://www.informatics.jax.org/homology/45241888", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q5T5A8-1", "protein_name": "Late cornified envelope protein 3C", "gene_name": "LCE3C", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSCQQNQQQCQPPPSCPSPKCPPKSPAQCLPPPSSDCALSSGGCGPSSESGCCLSHHRHFRSHQCRRQRSNSCDRGSGQQGGGSCRGHGSGGCC", "length": 94 }, "evidence": [ { "id": "45241887", "url": "http://www.informatics.jax.org/homology/45241887", "database": "MGI" }, { "id": "45241891", "url": "http://www.informatics.jax.org/homology/45241891", "database": "MGI" }, { "id": "45241892", "url": "http://www.informatics.jax.org/homology/45241892", "database": "MGI" }, { "id": "45241890", "url": "http://www.informatics.jax.org/homology/45241890", "database": "MGI" }, { "id": "45241888", "url": "http://www.informatics.jax.org/homology/45241888", "database": "MGI" }, { "id": "45241889", "url": "http://www.informatics.jax.org/homology/45241889", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q5T5B0-1", "protein_name": "Late cornified envelope protein 3E", "gene_name": "LCE3E", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSCQQNQKQCQPPPKCPSPKCPPKNPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRSNSCDRGSGQQGGGSGCCHGSGGCC", "length": 92 }, "evidence": [ { "id": "45241887", "url": "http://www.informatics.jax.org/homology/45241887", "database": "MGI" }, { "id": "45241891", "url": "http://www.informatics.jax.org/homology/45241891", "database": "MGI" }, { "id": "45241888", "url": "http://www.informatics.jax.org/homology/45241888", "database": "MGI" }, { "id": "45241889", "url": "http://www.informatics.jax.org/homology/45241889", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q5TA77-1", "protein_name": "Late cornified envelope protein 3B", "gene_name": "LCE3B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSCQQNQQQCQPLPKCPSPKCPPKSSAQCLPPASSCCAPRPGCCGGPSSEGGCCLSHHRCCRSHRCRRQSSNSCDRGSGQQDGASDCGYGSGGCC", "length": 95 }, "evidence": [ { "id": "45241887", "url": "http://www.informatics.jax.org/homology/45241887", "database": "MGI" }, { "id": "45241891", "url": "http://www.informatics.jax.org/homology/45241891", "database": "MGI" }, { "id": "45241892", "url": "http://www.informatics.jax.org/homology/45241892", "database": "MGI" }, { "id": "45241890", "url": "http://www.informatics.jax.org/homology/45241890", "database": "MGI" }, { "id": "45241888", "url": "http://www.informatics.jax.org/homology/45241888", "database": "MGI" }, { "id": "45241889", "url": "http://www.informatics.jax.org/homology/45241889", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q6PAI4-1", "protein_name": "Late cornified envelope 3F", "gene_name": "Lce3f", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSCQQSQKQCQPPPKCPSPKCSPKCPPKSTTQCLPAASSCCATSSGGCSLPSSEGGCCLSHHRRRSHRCRRRSSSSCDRGSGQQSGGSGCGHSSGGCC", "length": 98 }, "evidence": [ { "id": "45241887", "url": "http://www.informatics.jax.org/homology/45241887", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q91V05-1", "protein_name": "EIG3", "gene_name": "Lce3c", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSCQQSQKQCQPPPKCPSPKCSPKCPPKSTAQCLPAASSCCATSSGGCSLPSSEGGCCLSHHRRRSHRCRRRSSSSCDRGSGQQSGGSGCGHSSGGCC", "length": 98 }, "evidence": [ { "id": "45241889", "url": "http://www.informatics.jax.org/homology/45241889", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BYE3-1", "protein_name": "Late cornified envelope protein 3D", "gene_name": "LCE3D", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSCQQNQQQCQPPPKCPSPKCPPKSPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRPNSCDRGSGQQGGGSGCGHGSGGCC", "length": 92 }, "evidence": [ { "id": "45241887", "url": "http://www.informatics.jax.org/homology/45241887", "database": "MGI" }, { "id": "45241891", "url": "http://www.informatics.jax.org/homology/45241891", "database": "MGI" }, { "id": "45241892", "url": "http://www.informatics.jax.org/homology/45241892", "database": "MGI" }, { "id": "45241890", "url": "http://www.informatics.jax.org/homology/45241890", "database": "MGI" }, { "id": "45241888", "url": "http://www.informatics.jax.org/homology/45241888", "database": "MGI" }, { "id": "45241889", "url": "http://www.informatics.jax.org/homology/45241889", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9CQM7-1", "protein_name": "Late cornified envelope 3B", "gene_name": "Lce3b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSCQQSQKQCQPPPKCPSPKCSPKCPRKSTAQCLPAASSCCATNSGGCSLPRSEGGCCLSHHRRRSHRCRRRSSSSCDRGSGQQSGGSGCGHSSGDCC", "length": 98 }, "evidence": [ { "id": "45241891", "url": "http://www.informatics.jax.org/homology/45241891", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "keratinization", "id": "GO:0031424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031424", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAB7", "url": "https://www.uniprot.org/uniprot/A0A0G2KAB7" } ], "pmid": "" }, { "name": "defense response to Gram-negative bacterium", "id": "GO:0050829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050829", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAB7", "url": "https://www.uniprot.org/uniprot/A0A0G2KAB7" } ], "pmid": "" }, { "name": "defense response to Gram-positive bacterium", "id": "GO:0050830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAB7", "url": "https://www.uniprot.org/uniprot/A0A0G2KAB7" } ], "pmid": "" }, { "name": "killing of cells of another organism", "id": "GO:0031640", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031640", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2KAB7", "url": "https://www.uniprot.org/uniprot/A0A0G2KAB7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }