{ "uniprot_canonical_ac": "A0A0G2K7Z7-1", "uniprot_ac": "A0A0G2K7Z7", "uniprot_id": "A0A0G2K7Z7_RAT", "mass": { "chemical_mass": 38707.0, "monoisotopic_mass": 38707.0 }, "refseq": { "ac": "NP_001102273", "name": "2-acylglycerol O-acyltransferase 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102273" }, "gene_names": [ { "name": "Mogat1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z7", "id": "A0A0G2K7Z7" }, { "name": "Mogat1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102273", "id": "NP_001102273" } ], "protein_names": [ { "name": "Acyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0G2K7Z7" }, { "name": "2-acylglycerol O-acyltransferase 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001102273", "id": "NP_001102273" }, { "name": "2.3.1.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K7Z7" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z7", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z7" } ], "common_name": "Rat" } ], "gene": [ { "name": "Mogat1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z7", "locus": { "chromosome": "9", "start_pos": 79988513, "end_pos": 79956649, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000014692", "url": "https://www.ensembl.org/id/ENSRNOG00000014692" } ] } } ], "crossref": [ { "id": "ENSRNOG00000014692", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000014692", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd07987", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07987", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "363261", "url": "https://www.ncbi.nlm.nih.gov/gene/363261", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR007130", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007130", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:363261", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:363261", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WIKNWTL", "url": "https://omabrowser.org/oma/group/WIKNWTL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "601258at2759", "url": "http://www.orthodb.org/?query=601258at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12317", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12317", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12317:SF26", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12317:SF26", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03982", "url": "http://pfam.xfam.org/family/PF03982", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-75109", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-75109", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "1311644", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1311644", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K7Z7", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K7Z7-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4A6J3", "url": "https://www.uniprot.org/uniprot/D4A6J3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D4A6J3-1", "url": "https://www.uniprot.org/uniprot/D4A6J3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMVEFEPSNSLLARCLQTAAMLQGILVILVLIPGSIGIMVMLILYNYWFLYIPYLVWCYYDRRTPEQGGRRWSWVQNWTVWKYFMDYFPIHLVKTQDLDPAHNYIFGFHPHGIFVFGAFGNFCTNYSDFKKLFPGFTSYLHVAVSWFWLPLFREYALSNGPVSVSKRSLSHVMSKEGGGNISVIVIGGAKELLESFPGRYSLCLLQRKGFVKIALTHGAHLVPVFSFGENELYSQVDNPKGSWLRTAQDKVYNLTGLALPLFYARGIFQNSFGLMPYRKLIYTVVGRPIPVQKTLHPTPEQIDELHQTYMEELRKLFNEHKGKYGIPEHETLVFK", "length": 335, "header": "tr|A0A0G2K7Z7-1|A0A0G2K7Z7_RAT Isoform 1 of Acyltransferase OS=Rattus norvegicus OX=10116 GN=Mogat1 PE=3 SV=2 CANONICAL=A0A0G2K7Z7-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K7Z7-1", "url": "", "sequence": { "sequence": "MMVEFEPSNSLLARCLQTAAMLQGILVILVLIPGSIGIMVMLILYNYWFLYIPYLVWCYYDRRTPEQGGRRWSWVQNWTVWKYFMDYFPIHLVKTQDLDPAHNYIFGFHPHGIFVFGAFGNFCTNYSDFKKLFPGFTSYLHVAVSWFWLPLFREYALSNGPVSVSKRSLSHVMSKEGGGNISVIVIGGAKELLESFPGRYSLCLLQRKGFVKIALTHGAHLVPVFSFGENELYSQVDNPKGSWLRTAQDKVYNLTGLALPLFYARGIFQNSFGLMPYRKLIYTVVGRPIPVQKTLHPTPEQIDELHQTYMEELRKLFNEHKGKYGIPEHETLVFK", "length": 335, "header": "tr|A0A0G2K7Z7-1|A0A0G2K7Z7_RAT Isoform 1 of Acyltransferase OS=Rattus norvegicus OX=10116 GN=Mogat1 PE=3 SV=2 CANONICAL=A0A0G2K7Z7-1" }, "locus": { "chromosome": "9", "start_pos": 79988432, "end_pos": 79956649, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000082378.2", "url": "https://www.ensembl.org/id/ENSRNOT00000082378.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000074410.2", "url": "https://www.ensembl.org/id/ENSRNOP00000074410.2" } ] } }, { "isoform_ac": "D4A6J3-1", "url": "", "sequence": { "sequence": "MSKEGGGNISVIVIGGAKELLESFPGRYSLCLLQRKGFVKIALTHGAHLVPVFSFGENELYSQVDNPKGSWLRTAQDKVYNLTGLALPLFYARGIFQNSFGLMPYRKLIYTVAAVGTAARLTQKSNHQNDSSVSAEKGNSFICCQVGWCDRDRQPLAAPSLFRRLCTRPQSRLMSCIRRTWRS", "length": 183, "header": "tr|D4A6J3-1|D4A6J3_RAT Computationally mapped isoform of Monoacylglycerol O-acyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Mogat1 PE=3 SV=1 CANONICAL=A0A0G2K7Z7-1" }, "locus": { "chromosome": "9", "start_pos": 79988364, "end_pos": 79981014, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000019724.5", "url": "https://www.ensembl.org/id/ENSRNOT00000019724.5" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000019724.4", "url": "https://www.ensembl.org/id/ENSRNOP00000019724.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "rno:363261", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:363261", "resource": "KEGG Pathway" }, { "id": "R-RNO-75109", "name": "Triglyceride biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-75109", "resource": "Reactome", "description": "Triglyceride biosynthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "Q91ZV4-1", "protein_name": "2-acylglycerol O-acyltransferase 1", "gene_name": "Mogat1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMVEFAPLNTPLARCLQTAAVLQWVLSFLLLVQVCIGIMVMLVLYNYWFLYIPYLVWFYYDWRTPEQGGRRWNWVQSWPVWKYFKEYFPICLVKTQDLDPGHNYIFGFHPHGIFVPGAFGNFCTKYSDFKKLFPGFTSYLHVAKIWFCFPLFREYLMSNGPVSVSKESLSHVLSKDGGGNVSIIVLGGAKEALEAHPGTFTLCIRQRKGFVKMALTHGASLVPVFSFGENDLYKQINNPKGSWLRTIQDAMYDSMGVALPLIYARGIFQHYFGIMPYRKLIYTVVGRPIPVQQTLNPTSEQIEELHQTYLEELKKLFNEHKGKYGIPEHETLVFK", "length": 335 }, "evidence": [ { "id": "45242397", "url": "http://www.informatics.jax.org/homology/45242397", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q96PD6-1", "protein_name": "2-acylglycerol O-acyltransferase 1", "gene_name": "MOGAT1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKVEFAPLNIQLARRLQTVAVLQWVLKYLLLGPMSIGITVMLIIHNYLFLYIPYLMWLYFDWHTPERGGRRSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFGNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPEGSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK", "length": 335 }, "evidence": [ { "id": "45242397", "url": "http://www.informatics.jax.org/homology/45242397", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z7", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z7" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z7", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z7" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z7", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "diacylglycerol biosynthetic process", "id": "GO:0006651", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006651", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z7", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z7" } ], "pmid": "" }, { "name": "triglyceride biosynthetic process", "id": "GO:0019432", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019432", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z7", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "diacylglycerol O-acyltransferase activity", "id": "GO:0004144", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004144", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z7", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z7" } ], "pmid": "" }, { "name": "2-acylglycerol O-acyltransferase activity", "id": "GO:0003846", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003846", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7Z7", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 125, "end_pos": 127, "annotation": "n_glycosylation_sequon" }, { "start_pos": 180, "end_pos": 182, "annotation": "n_glycosylation_sequon" }, { "start_pos": 253, "end_pos": 255, "annotation": "n_glycosylation_sequon" }, { "start_pos": 77, "end_pos": 79, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-RNO-6800334", "name": "MOGAT1,2,3 transfer acyl group from acyl-CoA to 2-acylglycerol to form DAG", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-6800352" ], "output_participant_list": [ "R-ALL-76103" ], "enzyme_list": [ "B2RZ21-1", "A0A0G2K7Z7-1" ], "evidence": [ { "id": "R-RNO-6800334", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6800334" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-6800352", "participant_name": "2AG [cytosol]", "crossref": [ { "id": "C02112", "database": "COMPOUND", "url": "" }, { "id": "17389", "database": "ChEBI", "url": "" }, { "id": "C02112", "database": "COMPOUND", "url": "" }, { "id": "17389", "database": "ChEBI", "url": "" }, { "id": "C02112", "database": "COMPOUND", "url": "" }, { "id": "17389", "database": "ChEBI", "url": "" }, { "id": "C02112", "database": "COMPOUND", "url": "" }, { "id": "17389", "database": "ChEBI", "url": "" }, { "id": "17389", "database": "ChEBI", "url": "" }, { "id": "C02112", "database": "COMPOUND", "url": "" }, { "id": "C02112", "database": "COMPOUND", "url": "" }, { "id": "17389", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-76103", "participant_name": "DAG [cytosol]", "crossref": [ { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" }, { "id": "C00165", "database": "COMPOUND", "url": "" }, { "id": "17815", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K7Z7", "gene_name": "Mogat1", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "A0A0G2K7Z7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K7Z7" } ] } ] }, { "uniprot_ac": "B2RZ21", "gene_name": "Mogat2", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "B2RZ21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RZ21" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }