{ "uniprot_canonical_ac": "A0A0G2K7D0-1", "uniprot_ac": "A0A0G2K7D0", "uniprot_id": "A0A0G2K7D0_RAT", "mass": { "chemical_mass": 23323.0, "monoisotopic_mass": 23323.0 }, "refseq": {}, "gene_names": [ { "name": "Ccdc28b", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K7D0", "id": "A0A0G2K7D0" } ], "protein_names": [ { "name": "Coiled coil domain containing 28B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K7D0" } ], "function": [], "disease": [ { "disease_id": "DOID:0110123", "recommended_name": { "id": "DOID:0110123", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110123", "name": "Bardet-Biedl syndrome 1", "description": "A Bardet-Biedl syndrome that has_material_basis_in homozygous mutation in the BBS1 gene on chromosome 11q13." }, "synonyms": [ { "id": "DOID:0110123", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110123", "name": "BBS1", "description": "" }, { "id": "MONDO:0008854", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008854", "name": "Bardet-Biedl syndrome 1", "description": "A Bardet-Biedl syndrome that has material basis in homozygous mutation in the BBS1 gene on chromosome 11q13." }, { "id": "MONDO:0008854", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008854", "name": "BBS1", "description": "" }, { "id": "MONDO:0008854", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008854", "name": "Bardet-Biedl syndrome 1", "description": "" }, { "id": "MONDO:0008854", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008854", "name": "Bardet-Biedl syndrome 1, modifier of", "description": "" }, { "id": "MONDO:0008854", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008854", "name": "Bardet-Biedl syndrome type 1", "description": "" }, { "id": "MIM:209900", "resource": "MIM", "url": "https://www.omim.org/entry/209900", "name": "Bardet-Biedl syndrome", "description": "Bardet-Biedl syndrome" } ], "evidence": [ { "id": "0110123", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110123" } ] }, { "disease_id": "DOID:1935", "recommended_name": { "id": "DOID:1935", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1935", "name": "Bardet-Biedl syndrome", "description": "A syndrome that results from mutations in multiple BBS genes affecting cellular cilia structure or function (ciliopathy) resulting in variable presentation and characterized principally by obesity, retinitis pigmentosa,vision loss, polydactyly, mental retardation, hypogonadism, and renal failure in some cases." }, "synonyms": [ { "id": "MONDO:0008854", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008854", "name": "Bardet-Biedl syndrome 1", "description": "A Bardet-Biedl syndrome that has material basis in homozygous mutation in the BBS1 gene on chromosome 11q13." }, { "id": "MONDO:0008854", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008854", "name": "BBS1", "description": "" }, { "id": "MONDO:0008854", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008854", "name": "Bardet-Biedl syndrome 1", "description": "" }, { "id": "MONDO:0008854", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008854", "name": "Bardet-Biedl syndrome 1, modifier of", "description": "" }, { "id": "MONDO:0008854", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008854", "name": "Bardet-Biedl syndrome type 1", "description": "" }, { "id": "MIM:209900", "resource": "MIM", "url": "https://www.omim.org/entry/209900", "name": "Bardet-Biedl syndrome", "description": "Bardet-Biedl syndrome" } ], "evidence": [ { "id": "1935", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1935" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7D0", "url": "https://www.uniprot.org/uniprot/A0A0G2K7D0" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ccdc28b", "url": "https://www.uniprot.org/uniprot/A0A0G2K7D0", "locus": { "chromosome": "5", "start_pos": 141962276, "end_pos": 141967382, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000047578", "url": "https://www.ensembl.org/id/ENSRNOG00000047578" } ] } } ], "crossref": [ { "id": "IPR025271", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025271", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PHKEKAR", "url": "https://omabrowser.org/oma/group/PHKEKAR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR13400", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13400", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13400:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13400:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13270", "url": "http://pfam.xfam.org/family/PF13270", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "1583447", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1583447", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K7D0", "url": "https://www.uniprot.org/uniprot/A0A0G2K7D0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K7D0-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7D0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R957", "url": "https://www.uniprot.org/uniprot/M0R957", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R957-1", "url": "https://www.uniprot.org/uniprot/M0R957-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTRPEVRQHPMEDKKKKRSPKPCLTQPAQAPGTLRRVPVPTSHSGSLALGLPHLLSPKQRAKFKRVGKEKCRPVLAGGGGGSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCGEEEDEEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQPAA", "length": 210, "header": "tr|A0A0G2K7D0-1|A0A0G2K7D0_RAT Isoform 1 of Coiled coil domain containing 28B OS=Rattus norvegicus OX=10116 GN=Ccdc28b PE=4 SV=1 CANONICAL=A0A0G2K7D0-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K7D0-1", "url": "", "sequence": { "sequence": "MTRPEVRQHPMEDKKKKRSPKPCLTQPAQAPGTLRRVPVPTSHSGSLALGLPHLLSPKQRAKFKRVGKEKCRPVLAGGGGGSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCGEEEDEEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQPAA", "length": 210, "header": "tr|A0A0G2K7D0-1|A0A0G2K7D0_RAT Isoform 1 of Coiled coil domain containing 28B OS=Rattus norvegicus OX=10116 GN=Ccdc28b PE=4 SV=1 CANONICAL=A0A0G2K7D0-1" }, "locus": { "chromosome": "5", "start_pos": 141966878, "end_pos": 141962400, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000083369.2", "url": "https://www.ensembl.org/id/ENSRNOT00000083369.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000074154.2", "url": "https://www.ensembl.org/id/ENSRNOP00000074154.2" } ] } }, { "isoform_ac": "M0R957-1", "url": "", "sequence": { "sequence": "MEDKKKKRSPKPCLTQPAQAPGTLRRVPVPTSHSGSLALGLPHLLSPKQRAKFKRVGKEKCRPVLAGGGGGSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCGEEEDEEEEEDGVTEGLPEEQKKTMADRNLDQLLSNHRQKLHLAENAEPEEQPAA", "length": 194, "header": "tr|M0R957-1|M0R957_RAT Computationally mapped isoform of Coiled coil domain containing 28B OS=Rattus norvegicus OX=10116 GN=Ccdc28b PE=4 SV=1 CANONICAL=A0A0G2K7D0-1" }, "locus": { "chromosome": "5", "start_pos": 141966240, "end_pos": 141962400, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000075659.2", "url": "https://www.ensembl.org/id/ENSRNOT00000075659.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000066019.2", "url": "https://www.ensembl.org/id/ENSRNOP00000066019.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "centrosome", "id": "GO:0005813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7D0", "url": "https://www.uniprot.org/uniprot/A0A0G2K7D0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "cilium assembly", "id": "GO:0060271", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060271", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7D0", "url": "https://www.uniprot.org/uniprot/A0A0G2K7D0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }