{ "uniprot_canonical_ac": "A0A0G2K764-1", "uniprot_ac": "A0A0G2K764", "uniprot_id": "A0A0G2K764_RAT", "mass": { "chemical_mass": 71388.0, "monoisotopic_mass": 71388.0 }, "refseq": {}, "gene_names": [ { "name": "Txnrd3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K764", "id": "A0A0G2K764" } ], "protein_names": [ { "name": "thioredoxin-disulfide reductase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0G2K764" }, { "name": "1.8.1.9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K764" } ], "function": [], "disease": [ { "disease_id": "DOID:0050860", "recommended_name": { "id": "DOID:0050860", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050860", "name": "colorectal adenoma", "description": "An intestinal benign neoplasm that has_material_basis_in epithelial tissue of glandular origin and is located_in colon and located_in rectum." }, "synonyms": [], "evidence": [ { "id": "0050860", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050860" } ] }, { "disease_id": "DOID:0080199", "recommended_name": { "id": "DOID:0080199", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080199", "name": "colorectal carcinoma", "description": "A colorectal cancer that arises from the colon or rectum and invades through the muscularis mucosa into the submucosa." }, "synonyms": [], "evidence": [ { "id": "0080199", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080199" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K764", "url": "https://www.uniprot.org/uniprot/A0A0G2K764" } ], "common_name": "Rat" } ], "gene": [ { "name": "Txnrd3", "url": "https://www.uniprot.org/uniprot/A0A0G2K764", "locus": { "chromosome": "4", "start_pos": 122112491, "end_pos": 122072548, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000059810", "url": "https://www.ensembl.org/id/ENSRNOG00000059810" } ] } } ], "crossref": [ { "id": "ENSRNOG00000059810", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000059810", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03419", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03419", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001100", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001100", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002109", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002109", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004099", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004099", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006338", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006338", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011899", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011899", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012999", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012999", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016156", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016156", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023753", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023753", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036188", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036188", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036249", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046952", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046952", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "HPTCGEI", "url": "https://omabrowser.org/oma/group/HPTCGEI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR42737", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR42737", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR42737:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR42737:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00462", "url": "http://pfam.xfam.org/family/PF00462", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02852", "url": "http://pfam.xfam.org/family/PF02852", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07992", "url": "http://pfam.xfam.org/family/PF07992", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "1308363", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1308363", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "20345", "url": "https://www.rhea-db.org/rhea/20345", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2K0G3", "url": "https://www.uniprot.org/uniprot/A0A0G2K0G3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K0G3-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K0G3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K764", "url": "https://www.uniprot.org/uniprot/A0A0G2K764", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K764-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K764-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "LEKPPSPPPPPRAQTSPGQGKAGVVPNRRLGAVRGGLMSSPPGRRARLTSPGTSRPPAEVREEVRRRLRDLIEGNRVMIFSKSYCPHSSRVKELFSSLGVNYYILELDQVDDGANVQEVLTEISNQKTVPNIFVNKVHVGGCDRIFQAHQNGLLQKLLQDDSTHDYDLIVIGGGSGGLSCAKEAANLGKKVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGHALQDARKYGWDYNQQVKHNWETMREAIQNHIGSLNWGYRVTLREKGVTYVNSFGEFVELHKIKATNKKGQETFYTASKFVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGNTLIVGASYVGLECAGFLAGLGLDVTVMVRSVLLRGFDQEMAEKVGSYLEQQGVKFQRKFTPILVQQLEKGLPGRLKVVAKSTEGPETVEGTYNTVLLAIGRDSCTRKIGLEKIGVKINEKNGKIPVNDVEQTNVPHVYAIGDVLEGKPELTPVAIQAGKLLARRLFGISLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEMYTKENLEVYHTFFWPLEWTVAGRDNNTCYAKIICNKFDNDRVIGFHLLGPNAGEVTQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTMEITKSSGLDITQKGC", "length": 650, "header": "tr|A0A0G2K764-1|A0A0G2K764_RAT Isoform 1 of thioredoxin-disulfide reductase OS=Rattus norvegicus OX=10116 GN=Txnrd3 PE=1 SV=2 CANONICAL=A0A0G2K764-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K0G3-1", "url": "", "sequence": { "sequence": "MSSPPGRRARLTSPGTSRPPAEVREEVKELFSSLGVNYYILELDQVDDGANVQEVLTEISNQKTVPNIFVNKVHVGGCDRIFQAHQNGLLQKLLQDDSTHDYDLIVIGGGSGGLSCAKEAANLGKKVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGHALQDARKYGWDYNQQVKHNWETMREAIQNHIGSLNWGYRVTLREKGVTYVNSFGEFVELHKIKATNKKGQETFYTASKFVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGNTLIVGASYVGLECAGFLAGLGLDVTVMVRSVLLRGFDQEMAEKVGSYLEQQGVKFQRKFTPILVQQLEKGLPGRLKVVAKSTEGPETVEGTYNTVLLAIGRDSCTRKIGLEKIGVKINEKNGKIPVNDVEQTNVPHVYAIGDVLEGKPELTPVAIQAGKLLARRLFGISLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEMYTKENLEVYHTFFWPLEWTVAGRDNNTCYAKIICNKFDNDRVIGFHLLGPNAGEVTQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTMEITKSSGLDITQKGC", "length": 586, "header": "tr|A0A0G2K0G3-1|A0A0G2K764_RAT Computationally mapped isoform of thioredoxin-disulfide reductase OS=Rattus norvegicus OX=10116 GN=Txnrd3 PE=1 SV=2 CANONICAL=A0A0G2K764-1" }, "locus": { "chromosome": "4", "start_pos": 122111805, "end_pos": 122072804, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000077374.2", "url": "https://www.ensembl.org/id/ENSRNOT00000077374.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000071434.2", "url": "https://www.ensembl.org/id/ENSRNOP00000071434.2" } ] } }, { "isoform_ac": "A0A0G2K764-1", "url": "", "sequence": { "sequence": "LEKPPSPPPPPRAQTSPGQGKAGVVPNRRLGAVRGGLMSSPPGRRARLTSPGTSRPPAEVREEVRRRLRDLIEGNRVMIFSKSYCPHSSRVKELFSSLGVNYYILELDQVDDGANVQEVLTEISNQKTVPNIFVNKVHVGGCDRIFQAHQNGLLQKLLQDDSTHDYDLIVIGGGSGGLSCAKEAANLGKKVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGHALQDARKYGWDYNQQVKHNWETMREAIQNHIGSLNWGYRVTLREKGVTYVNSFGEFVELHKIKATNKKGQETFYTASKFVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGNTLIVGASYVGLECAGFLAGLGLDVTVMVRSVLLRGFDQEMAEKVGSYLEQQGVKFQRKFTPILVQQLEKGLPGRLKVVAKSTEGPETVEGTYNTVLLAIGRDSCTRKIGLEKIGVKINEKNGKIPVNDVEQTNVPHVYAIGDVLEGKPELTPVAIQAGKLLARRLFGISLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEMYTKENLEVYHTFFWPLEWTVAGRDNNTCYAKIICNKFDNDRVIGFHLLGPNAGEVTQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTMEITKSSGLDITQKGC", "length": 650, "header": "tr|A0A0G2K764-1|A0A0G2K764_RAT Isoform 1 of thioredoxin-disulfide reductase OS=Rattus norvegicus OX=10116 GN=Txnrd3 PE=1 SV=2 CANONICAL=A0A0G2K764-1" }, "locus": { "chromosome": "4", "start_pos": 122111805, "end_pos": 122072693, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000084494.2", "url": "https://www.ensembl.org/id/ENSRNOT00000084494.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000074078.2", "url": "https://www.ensembl.org/id/ENSRNOP00000074078.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "thioredoxin-disulfide reductase activity", "id": "GO:0004791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004791", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K764", "url": "https://www.uniprot.org/uniprot/A0A0G2K764" } ], "pmid": "" }, { "name": "flavin adenine dinucleotide binding", "id": "GO:0050660", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050660", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K764", "url": "https://www.uniprot.org/uniprot/A0A0G2K764" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K764", "url": "https://www.uniprot.org/uniprot/A0A0G2K764" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K764", "url": "https://www.uniprot.org/uniprot/A0A0G2K764" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K764", "url": "https://www.uniprot.org/uniprot/A0A0G2K764" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K764", "url": "https://www.uniprot.org/uniprot/A0A0G2K764" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "cell redox homeostasis", "id": "GO:0045454", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045454", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K764", "url": "https://www.uniprot.org/uniprot/A0A0G2K764" } ], "pmid": "" }, { "name": "blastocyst formation", "id": "GO:0001825", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001825", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K764", "url": "https://www.uniprot.org/uniprot/A0A0G2K764" } ], "pmid": "" }, { "name": "glutathione metabolic process", "id": "GO:0006749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006749", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K764", "url": "https://www.uniprot.org/uniprot/A0A0G2K764" } ], "pmid": "" }, { "name": "response to oxidative stress", "id": "GO:0006979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006979", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K764", "url": "https://www.uniprot.org/uniprot/A0A0G2K764" } ], "pmid": "" }, { "name": "response to inorganic substance", "id": "GO:0010035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010035", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K764", "url": "https://www.uniprot.org/uniprot/A0A0G2K764" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 571, "end_pos": 573, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "20345", "name": "", "equation": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q1H5H1-1", "O89049-1", "Q9Z0J5-1", "A0A0G2K764-1", "P62341-1", "Q9NNW7-1", "Q86VQ6-1", "Q16881-1", "P62342-1", "Q9JLT4-1", "Q99MD6-1", "Q9JMH6-1", "P29509-1", "P38816-1", "Q54UU8-1", "Q9VMV6-1", "P91938-1", "Q9VNT5-1" ], "evidence": [ { "id": "20345", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/20345" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K764", "gene_name": "Txnrd3", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "A0A0G2K764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K764" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "A0A0G2K764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K764" } ] } ] }, { "uniprot_ac": "O89049", "gene_name": "Txnrd1", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "O89049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89049" } ] }, { "ec_number": "1.11.1.2", "activity": "H(+) + H2O2 + NADPH = 2 H2O + NADP(+).", "evidence": [ { "id": "O89049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89049" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "O89049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89049" } ] } ] }, { "uniprot_ac": "P29509", "gene_name": "TRR1", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "P29509", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29509" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "P29509", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29509" } ] } ] }, { "uniprot_ac": "P38816", "gene_name": "TRR2", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "P38816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38816" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "P38816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P38816" } ] } ] }, { "uniprot_ac": "P62341", "gene_name": "SELENOT", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "P62341", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62341" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "P62341", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62341" } ] } ] }, { "uniprot_ac": "P62342", "gene_name": "Selenot", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "P62342", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62342" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "P62342", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62342" } ] } ] }, { "uniprot_ac": "P91938", "gene_name": "Trxr1", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "P91938", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P91938" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "P91938", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P91938" } ] } ] }, { "uniprot_ac": "Q16881", "gene_name": "TXNRD1", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "Q16881", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16881" } ] }, { "ec_number": "1.11.1.2", "activity": "H(+) + H2O2 + NADPH = 2 H2O + NADP(+).", "evidence": [ { "id": "Q16881", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16881" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "Q16881", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16881" } ] } ] }, { "uniprot_ac": "Q1H5H1", "gene_name": "Selenot", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "Q1H5H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1H5H1" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "Q1H5H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1H5H1" } ] } ] }, { "uniprot_ac": "Q54UU8", "gene_name": "trrA", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "Q54UU8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54UU8" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "Q54UU8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54UU8" } ] } ] }, { "uniprot_ac": "Q86VQ6", "gene_name": "TXNRD3", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "Q86VQ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86VQ6" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "Q86VQ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86VQ6" } ] } ] }, { "uniprot_ac": "Q99MD6", "gene_name": "Txnrd3", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "Q99MD6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MD6" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "Q99MD6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99MD6" } ] } ] }, { "uniprot_ac": "Q9JLT4", "gene_name": "Txnrd2", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "Q9JLT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLT4" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "Q9JLT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLT4" } ] } ] }, { "uniprot_ac": "Q9JMH6", "gene_name": "Txnrd1", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "Q9JMH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JMH6" } ] }, { "ec_number": "1.11.1.2", "activity": "H(+) + H2O2 + NADPH = 2 H2O + NADP(+).", "evidence": [ { "id": "Q9JMH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JMH6" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "Q9JMH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JMH6" } ] } ] }, { "uniprot_ac": "Q9NNW7", "gene_name": "TXNRD2", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "Q9NNW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NNW7" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "Q9NNW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NNW7" } ] } ] }, { "uniprot_ac": "Q9VMV6", "gene_name": "SelT", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "Q9VMV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMV6" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "Q9VMV6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMV6" } ] } ] }, { "uniprot_ac": "Q9VNT5", "gene_name": "Trxr2", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "Q9VNT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VNT5" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "Q9VNT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VNT5" } ] } ] }, { "uniprot_ac": "Q9Z0J5", "gene_name": "Txnrd2", "activity": [ { "ec_number": "1.8.1.9", "activity": "[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH.", "evidence": [ { "id": "Q9Z0J5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0J5" } ] }, { "ec_number": "1.8.1.9", "activity": "", "evidence": [ { "id": "Q9Z0J5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0J5" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }