{ "uniprot_canonical_ac": "A0A0G2K6P0-1", "uniprot_ac": "A0A0G2K6P0", "uniprot_id": "A0A0G2K6P0_RAT", "mass": { "chemical_mass": 9070.0, "monoisotopic_mass": 9070.0 }, "refseq": {}, "gene_names": [ { "name": "Cox7b2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K6P0", "id": "A0A0G2K6P0" } ], "protein_names": [ { "name": "Cytochrome c oxidase subunit 7B2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K6P0" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K6P0", "url": "https://www.uniprot.org/uniprot/A0A0G2K6P0" } ], "common_name": "Rat" } ], "gene": [ { "name": "Cox7b2", "url": "https://www.uniprot.org/uniprot/A0A0G2K6P0", "locus": { "chromosome": "14", "start_pos": 36805523, "end_pos": 36693105, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000057953", "url": "https://www.ensembl.org/id/ENSRNOG00000057953" } ] } } ], "crossref": [ { "id": "ENSRNOG00000057953", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000057953", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "100361960", "url": "https://www.ncbi.nlm.nih.gov/gene/100361960", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR008433", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008433", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023272", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023272", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:100361960", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:100361960", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "QIRARQS", "url": "https://omabrowser.org/oma/group/QIRARQS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5347758at2759", "url": "http://www.orthodb.org/?query=5347758at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR16716", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16716", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16716:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16716:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05392", "url": "http://pfam.xfam.org/family/PF05392", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_006221796", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006221796", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "2319120", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2319120", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K6P0", "url": "https://www.uniprot.org/uniprot/A0A0G2K6P0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K6P0-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K6P0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMLPLARCALNHLKIQSIPKVVGRQKHSKPSSNFHDKYGNMMLFSGSAFCLGAYIIFMTQMGVEWNLSPVGRVTPKEWNE", "length": 80, "header": "tr|A0A0G2K6P0-1|A0A0G2K6P0_RAT Isoform 1 of Cytochrome c oxidase subunit 7B2 OS=Rattus norvegicus OX=10116 GN=Cox7b2 PE=3 SV=1 CANONICAL=A0A0G2K6P0-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K6P0-1", "url": "", "sequence": { "sequence": "MMLPLARCALNHLKIQSIPKVVGRQKHSKPSSNFHDKYGNMMLFSGSAFCLGAYIIFMTQMGVEWNLSPVGRVTPKEWNE", "length": 80, "header": "tr|A0A0G2K6P0-1|A0A0G2K6P0_RAT Isoform 1 of Cytochrome c oxidase subunit 7B2 OS=Rattus norvegicus OX=10116 GN=Cox7b2 PE=3 SV=1 CANONICAL=A0A0G2K6P0-1" }, "locus": { "chromosome": "14", "start_pos": 36805206, "end_pos": 36804967, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000084367.2", "url": "https://www.ensembl.org/id/ENSRNOT00000084367.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000073886.1", "url": "https://www.ensembl.org/id/ENSRNOP00000073886.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:100361960", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:100361960", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8TF08-1", "protein_name": "Cytochrome c oxidase subunit 7B2, mitochondrial", "gene_name": "COX7B2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQIGIEWNLSPVGRVTPKEWKHQ", "length": 81 }, "evidence": [ { "id": "45239587", "url": "http://www.informatics.jax.org/homology/45239587", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9D2H1-1", "protein_name": "Cytochrome c oxidase subunit 7B2", "gene_name": "Cox7b2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMFPLARYALNYLKTPSILKIVGRLKHSKPSSEETHDKYGNMMLISGTIFCLAGYTIYMTQMGVEWNLSPIGRVTPQEWKKK", "length": 82 }, "evidence": [ { "id": "45239587", "url": "http://www.informatics.jax.org/homology/45239587", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K6P0", "url": "https://www.uniprot.org/uniprot/A0A0G2K6P0" } ], "pmid": "" }, { "name": "respiratory chain complex IV", "id": "GO:0045277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045277", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K6P0", "url": "https://www.uniprot.org/uniprot/A0A0G2K6P0" } ], "pmid": "" }, { "name": "mitochondrial respirasome", "id": "GO:0005746", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005746", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K6P0", "url": "https://www.uniprot.org/uniprot/A0A0G2K6P0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K6P0", "url": "https://www.uniprot.org/uniprot/A0A0G2K6P0" } ], "pmid": "" }, { "name": "mitochondrial electron transport, cytochrome c to oxygen", "id": "GO:0006123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006123", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K6P0", "url": "https://www.uniprot.org/uniprot/A0A0G2K6P0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 66, "end_pos": 68, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }