{ "uniprot_canonical_ac": "A0A0G2K5K4-1", "uniprot_ac": "A0A0G2K5K4", "uniprot_id": "A0A0G2K5K4_RAT", "mass": { "chemical_mass": 56994.0, "monoisotopic_mass": 56994.0 }, "refseq": {}, "gene_names": [ { "name": "Cyp3a62", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4", "id": "A0A0G2K5K4" }, { "name": "Cyp3a9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4", "id": "A0A0G2K5K4" } ], "protein_names": [ { "name": "Cytochrome P450 3A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0G2K5K4" }, { "name": "1.14.14.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K5K4" } ], "function": [ { "annotation": "Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5K4", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4#function" }, { "database": "UniProtKB", "id": "RU368049", "url": "https://www.uniprot.org/uniprot/RU368049#function" }, { "database": "UniProtKB", "id": "F7F0U1", "url": "https://www.uniprot.org/uniprot/F7F0U1#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5K4", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4" } ], "common_name": "Rat" } ], "gene": [ { "name": "Cyp3a62", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4", "locus": { "chromosome": "12", "start_pos": 16433833, "end_pos": 16397998, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000001379", "url": "https://www.ensembl.org/id/ENSRNOG00000001379" } ] } } ], "crossref": [ { "id": "ENSRNOG00000001379", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000001379", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd20650", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20650", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001128", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001128", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002402", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002402", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017972", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017972", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036396", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036396", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "HTRITVQ", "url": "https://omabrowser.org/oma/group/HTRITVQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR24302", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24302", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24302:SF31", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24302:SF31", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00067", "url": "http://pfam.xfam.org/family/PF00067", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-211958", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-211958", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-211981", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "1595919", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1595919", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "17149", "url": "https://www.rhea-db.org/rhea/17149", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2K5K4", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K5K4-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7F0U1", "url": "https://www.uniprot.org/uniprot/F7F0U1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7F0U1-1", "url": "https://www.uniprot.org/uniprot/F7F0U1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDLIPNISLETWMLLATILVLLYLYGTSTHGNFKKLGISGPKPLPFVGNILAYRHGFWEFDRHCHKKYGDIWGFYEGRQPILAITDPDIIKTVLVKECYSTFTNRRSFGPAGILKKAITLSEDEEWKRLRTLLSPTFTSGKLKEMFPIINQYADLLVKNVKHEAEKGNPITMKDIFGAYSMDVITGTSFGVNVDSLNNPQNPFVQKVKKLLKFNFLDPFFLSVILFPFLTPVFEAFDITVFPKDVMKFFRTSVERMKENRMQEKVKQRLDFLQLMINSQSSGDKESHQGLTDVEIVAQSIFFIFAGYETTSSALSFALYLLATHPDLQKKLQDEIDAALPNKAPVTYDVLVEMEYLDMVLNETLRLFPVGGRLERVCKKDVEINGVFIPKGTVVMVPTFALHKDPKCWPEPEEFCPERFRKKNQDSINPYIYLPFGNGPRNCIGMRFALMNMKIALVRVLQNFSFGPCKETQIPLKLRKKGFFQPEKPIILRAVSRD", "length": 497, "header": "tr|A0A0G2K5K4-1|A0A0G2K5K4_RAT Isoform 1 of Cytochrome P450 3A OS=Rattus norvegicus OX=10116 GN=Cyp3a62 PE=3 SV=2 CANONICAL=A0A0G2K5K4-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K5K4-1", "url": "", "sequence": { "sequence": "MDLIPNISLETWMLLATILVLLYLYGTSTHGNFKKLGISGPKPLPFVGNILAYRHGFWEFDRHCHKKYGDIWGFYEGRQPILAITDPDIIKTVLVKECYSTFTNRRSFGPAGILKKAITLSEDEEWKRLRTLLSPTFTSGKLKEMFPIINQYADLLVKNVKHEAEKGNPITMKDIFGAYSMDVITGTSFGVNVDSLNNPQNPFVQKVKKLLKFNFLDPFFLSVILFPFLTPVFEAFDITVFPKDVMKFFRTSVERMKENRMQEKVKQRLDFLQLMINSQSSGDKESHQGLTDVEIVAQSIFFIFAGYETTSSALSFALYLLATHPDLQKKLQDEIDAALPNKAPVTYDVLVEMEYLDMVLNETLRLFPVGGRLERVCKKDVEINGVFIPKGTVVMVPTFALHKDPKCWPEPEEFCPERFRKKNQDSINPYIYLPFGNGPRNCIGMRFALMNMKIALVRVLQNFSFGPCKETQIPLKLRKKGFFQPEKPIILRAVSRD", "length": 497, "header": "tr|A0A0G2K5K4-1|A0A0G2K5K4_RAT Isoform 1 of Cytochrome P450 3A OS=Rattus norvegicus OX=10116 GN=Cyp3a62 PE=3 SV=2 CANONICAL=A0A0G2K5K4-1" }, "locus": { "chromosome": "12", "start_pos": 16433621, "end_pos": 16398091, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000087229.2", "url": "https://www.ensembl.org/id/ENSRNOT00000087229.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000073459.2", "url": "https://www.ensembl.org/id/ENSRNOP00000073459.2" } ] } }, { "isoform_ac": "F7F0U1-1", "url": "", "sequence": { "sequence": "LLIFLLNLLPYRYGTSTHGNFKKLGISGPKPLPFVGNILAYRHGFWEFDRHCHKKYGDIWGFYEGRQPILAITDPDIIKTVLVKECYSTFTNRRSFGPAGILKKAITLSEDEEWKRLRTLLSPTFTSGKLKEMFPIINQYADLLVKNVKHEAEKGNPITMKDIFGAYSMDVITGTSFGVNVDSLNNPQNPFVQKVKKLLKFNFLDPFFLSVILFPFLTPVFEAFDITVFPKDVMKFFRTSVERMKENRMQEKVKQRLDFLQLMINSQSSGDKESHQGLTDVEIVAQSIFFIFAGYETTSSALSFALYLLATHPDLQKKLQDEIDAALPNKAPVTYDVLVEMEYLDMVLNETLRLFPVGGRLERVCKKDVEINGVFIPKGTVVMVPTFALHKDPKCWPEPEEFCPERFRKKNQDSINPYIYLPFGNGPRNCIGMRFALMNMKIALVRVLQNFSFGPCKETQIPLKLRKKGFFQPEKPIILRAVSRD", "length": 485, "header": "tr|F7F0U1-1|F7F0U1_RAT Computationally mapped isoform of Cytochrome P450 3A OS=Rattus norvegicus OX=10116 GN=Cyp3a62 PE=1 SV=3 CANONICAL=A0A0G2K5K4-1" }, "locus": { "chromosome": "12", "start_pos": 16433621, "end_pos": 16403996, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000001863.6", "url": "https://www.ensembl.org/id/ENSRNOT00000001863.6" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000001863.6", "url": "https://www.ensembl.org/id/ENSRNOP00000001863.6" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "R-RNO-211958", "name": "Miscellaneous substrates", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-211958", "resource": "Reactome", "description": "Miscellaneous substrates" }, { "id": "R-RNO-211981", "name": "Xenobiotics", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-211981", "resource": "Reactome", "description": "Xenobiotics" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "aromatase activity", "id": "GO:0070330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070330", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5K4", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4" } ], "pmid": "" }, { "name": "iron ion binding", "id": "GO:0005506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5K4", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4" } ], "pmid": "" }, { "name": "heme binding", "id": "GO:0020037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020037", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5K4", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4" } ], "pmid": "" }, { "name": "testosterone 6-beta-hydroxylase activity", "id": "GO:0050649", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050649", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5K4", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5K4", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "oxidative demethylation", "id": "GO:0070989", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070989", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5K4", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4" } ], "pmid": "" }, { "name": "steroid metabolic process", "id": "GO:0008202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008202", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5K4", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 361, "end_pos": 363, "annotation": "n_glycosylation_sequon" }, { "start_pos": 462, "end_pos": 464, "annotation": "n_glycosylation_sequon" }, { "start_pos": 6, "end_pos": 8, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "17149", "name": "", "equation": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P11711-1", "P05182-1", "A0A8I6A0P6-1", "P10633-1", "P51538-1", "P00176-1", "P05178-1", "P10610-1", "P13107-1", "P20812-1", "P33272-1", "P51870-1", "P00185-1", "Q64581-1", "P05179-1", "P51871-1", "P04167-1", "P04800-1", "P05183-1", "P10634-1", "P11510-1", "P12938-1", "P12939-1", "P15129-1", "P15149-1", "P20814-1", "P33273-1", "P51590-1", "Q64583-1", "Q64680-1", "P04799-1", "Q64678-1", "P08683-1", "P24464-1", "D4A820-1", "A0A0G2K5K4-1", "F1LT33-1", "G3V9D2-1", "Q9QXF7-1", "A0A8I5ZZ08-1", "P05181-1", "A0A087X1C5-1", "P08684-1", "P20853-1", "P04798-1", "P05177-1", "P33261-1", "Q86W10-1", "Q16678-1", "P98187-1", "P10632-1", "P11712-1", "P24462-1", "Q9HB55-1", "P13584-1", "Q16696-1", "Q9HCS2-1", "P33260-1", "Q02928-1", "Q08477-1", "Q9HBI6-1", "P78329-1", "P24903-1", "P20815-1", "Q6V0L0-1", "P20852-1", "O09158-1", "O55071-1", "Q64459-1", "Q64481-1", "O54749-1", "P11714-1", "P15392-1", "Q8CIM7-1", "P24456-1", "P56654-1", "P56655-1", "P56656-1", "P12791-1", "P56593-1", "O54750-1", "Q91WL5-1", "Q91X77-1", "Q64458-1", "P00186-1", "P00184-1", "Q05421-1", "Q6XVG2-1", "Q9D816-1", "P12790-1", "P24457-1", "Q9JMA7-1", "Q64462-1", "Q64464-1", "Q64429-1", "D3YYZ0-1", "D3Z2W7-1", "Q9WV19-1", "Q9DBX6-1", "B2RXZ2-1", "E9Q593-1", "A2A974-1", "A6H6J2-1", "Q9EQW4-1", "B2RXA7-1" ], "evidence": [ { "id": "17149", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17149" } ] }, { "id": "R-RNO-211882", "name": "CYP3A7 can 6beta-hydroxylate testosterone", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-30321" ], "output_participant_list": [ "R-ALL-213144" ], "enzyme_list": [ "A0A0G2K5K4-1", "P51538-1", "Q64581-1", "P04800-1", "P05183-1" ], "evidence": [ { "id": "R-RNO-211882", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-211882" } ] }, { "id": "R-RNO-211948", "name": "CYP3A4 can N-demethylate loperamide", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-213155" ], "output_participant_list": [ "R-ALL-213151" ], "enzyme_list": [ "A0A0G2K5K4-1", "P51538-1", "Q64581-1", "P04800-1", "P05183-1" ], "evidence": [ { "id": "R-RNO-211948", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-211948" } ] }, { "id": "R-RNO-211959", "name": "CYP3A43 6b-hydroxylates TEST", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "smooth endoplasmic reticulum", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K5K4-1", "P51538-1", "Q64581-1" ], "evidence": [ { "id": "R-RNO-211959", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-211959" } ] }, { "id": "R-RNO-213175", "name": "CYP3A4,5 oxidise AFB1 to AFXBO", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-156522" ], "output_participant_list": [ "R-ALL-156523" ], "enzyme_list": [ "A0A0G2K5K4-1", "P51538-1", "Q64581-1", "P04800-1", "P05183-1" ], "evidence": [ { "id": "R-RNO-213175", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-213175" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-156522", "participant_name": "AFB1 [endoplasmic reticulum lumen]", "crossref": [ { "id": "8147046", "database": "PubChem Substance", "url": "" }, { "id": "2504", "database": "ChEBI", "url": "" }, { "id": "000000402671", "database": "ZINC", "url": "" }, { "id": "HMDB0006552", "database": "HMDB Metabolite", "url": "" }, { "id": "C06800", "database": "COMPOUND", "url": "" }, { "id": "HMDB0006552", "database": "HMDB Metabolite", "url": "" }, { "id": "000000402671", "database": "ZINC", "url": "" }, { "id": "C06800", "database": "COMPOUND", "url": "" }, { "id": "8147046", "database": "PubChem Substance", "url": "" }, { "id": "2504", "database": "ChEBI", "url": "" }, { "id": "8147046", "database": "PubChem Substance", "url": "" }, { "id": "2504", "database": "ChEBI", "url": "" }, { "id": "C06800", "database": "COMPOUND", "url": "" }, { "id": "000000402671", "database": "ZINC", "url": "" }, { "id": "HMDB0006552", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-156523", "participant_name": "AFXBO [endoplasmic reticulum lumen]", "crossref": [ { "id": "30725", "database": "ChEBI", "url": "" }, { "id": "HMDB0006558", "database": "HMDB Metabolite", "url": "" }, { "id": "000006017718", "database": "ZINC", "url": "" }, { "id": "30725", "database": "ChEBI", "url": "" }, { "id": "HMDB0006558", "database": "HMDB Metabolite", "url": "" }, { "id": "000006017718", "database": "ZINC", "url": "" }, { "id": "30725", "database": "ChEBI", "url": "" }, { "id": "HMDB0006558", "database": "HMDB Metabolite", "url": "" }, { "id": "000006017718", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-213144", "participant_name": "6BHT [endoplasmic reticulum lumen]", "crossref": [ { "id": "34477", "database": "ChEBI", "url": "" }, { "id": "000005764534", "database": "ZINC", "url": "" }, { "id": "C14497", "database": "COMPOUND", "url": "" }, { "id": "34477", "database": "ChEBI", "url": "" }, { "id": "000005764534", "database": "ZINC", "url": "" }, { "id": "C14497", "database": "COMPOUND", "url": "" }, { "id": "34477", "database": "ChEBI", "url": "" }, { "id": "000005764534", "database": "ZINC", "url": "" }, { "id": "C14497", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-213151", "participant_name": "N-demethylated loperamide [endoplasmic reticulum lumen]", "crossref": [ { "id": "64043", "database": "ChEBI", "url": "" }, { "id": "000021981239", "database": "ZINC", "url": "" }, { "id": "HMDB0255118", "database": "HMDB Metabolite", "url": "" }, { "id": "64043", "database": "ChEBI", "url": "" }, { "id": "000021981239", "database": "ZINC", "url": "" }, { "id": "HMDB0255118", "database": "HMDB Metabolite", "url": "" }, { "id": "64043", "database": "ChEBI", "url": "" }, { "id": "000021981239", "database": "ZINC", "url": "" }, { "id": "HMDB0255118", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-213155", "participant_name": "LPAM [endoplasmic reticulum lumen]", "crossref": [ { "id": "C07080", "database": "COMPOUND", "url": "" }, { "id": "000000537928", "database": "ZINC", "url": "" }, { "id": "HMDB0004999", "database": "HMDB Metabolite", "url": "" }, { "id": "6532", "database": "ChEBI", "url": "" }, { "id": "C07080", "database": "COMPOUND", "url": "" }, { "id": "000000537928", "database": "ZINC", "url": "" }, { "id": "HMDB0004999", "database": "HMDB Metabolite", "url": "" }, { "id": "6532", "database": "ChEBI", "url": "" }, { "id": "000000537928", "database": "ZINC", "url": "" }, { "id": "C07080", "database": "COMPOUND", "url": "" }, { "id": "HMDB0004999", "database": "HMDB Metabolite", "url": "" }, { "id": "6532", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-30321", "participant_name": "TES [endoplasmic reticulum lumen]", "crossref": [ { "id": "8144176", "database": "PubChem Substance", "url": "" }, { "id": "000118912393", "database": "ZINC", "url": "" }, { "id": "C00535", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000234", "database": "HMDB Metabolite", "url": "" }, { "id": "2858", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "17347", "database": "ChEBI", "url": "" }, { "id": "17347", "database": "ChEBI", "url": "" }, { "id": "2858", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0000234", "database": "HMDB Metabolite", "url": "" }, { "id": "8144176", "database": "PubChem Substance", "url": "" }, { "id": "C00535", "database": "COMPOUND", "url": "" }, { "id": "000118912393", "database": "ZINC", "url": "" }, { "id": "000118912393", "database": "ZINC", "url": "" }, { "id": "C00535", "database": "COMPOUND", "url": "" }, { "id": "8144176", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0000234", "database": "HMDB Metabolite", "url": "" }, { "id": "2858", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "17347", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A087X1C5", "gene_name": "CYP2D7", "activity": [ { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "A0A087X1C5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A087X1C5" } ] }, { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "A0A087X1C5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A087X1C5" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "A0A087X1C5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A087X1C5" } ] } ] }, { "uniprot_ac": "A0A0G2K5K4", "gene_name": "Cyp3a62", "activity": [ { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "A0A0G2K5K4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K5K4" } ] } ] }, { "uniprot_ac": "A0A8I5ZZ08", "gene_name": "LOC103691092", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "A0A8I5ZZ08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZZ08" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "A0A8I5ZZ08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZZ08" } ] } ] }, { "uniprot_ac": "A0A8I6A0P6", "gene_name": "Cyp3a73", "activity": [ { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "A0A8I6A0P6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A0P6" } ] } ] }, { "uniprot_ac": "A2A974", "gene_name": "Cyp4a12b", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "A2A974", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2A974" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "A2A974", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2A974" } ] } ] }, { "uniprot_ac": "A6H6J2", "gene_name": "Cyp2b13", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "A6H6J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6H6J2" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "A6H6J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6H6J2" } ] } ] }, { "uniprot_ac": "B2RXA7", "gene_name": "Cyp26c1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "B2RXA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RXA7" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "B2RXA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RXA7" } ] } ] }, { "uniprot_ac": "B2RXZ2", "gene_name": "Cyp2a22", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "B2RXZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RXZ2" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "B2RXZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RXZ2" } ] } ] }, { "uniprot_ac": "D3YYZ0", "gene_name": "Cyp3a57", "activity": [ { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "D3YYZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3YYZ0" } ] } ] }, { "uniprot_ac": "D3Z2W7", "gene_name": "Cyp3a59", "activity": [ { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "D3Z2W7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z2W7" } ] } ] }, { "uniprot_ac": "D4A820", "gene_name": "Cyp2s1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "D4A820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A820" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "D4A820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A820" } ] } ] }, { "uniprot_ac": "E9Q593", "gene_name": "Cyp2b23", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "E9Q593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q593" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "E9Q593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q593" } ] } ] }, { "uniprot_ac": "F1LT33", "gene_name": "Cyp2b14", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "F1LT33", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LT33" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "F1LT33", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LT33" } ] } ] }, { "uniprot_ac": "G3V9D2", "gene_name": "Cyp2b21", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "G3V9D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V9D2" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "G3V9D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V9D2" } ] } ] }, { "uniprot_ac": "O09158", "gene_name": "Cyp3a25", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "O09158", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09158" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "O09158", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09158" } ] }, { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "O09158", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09158" } ] } ] }, { "uniprot_ac": "O54749", "gene_name": "Cyp2j5", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "O54749", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54749" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "O54749", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54749" } ] } ] }, { "uniprot_ac": "O54750", "gene_name": "Cyp2j6", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "O54750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54750" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "O54750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54750" } ] } ] }, { "uniprot_ac": "O55071", "gene_name": "Cyp2b19", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "O55071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55071" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "O55071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55071" } ] } ] }, { "uniprot_ac": "P00176", "gene_name": "Cyp2b1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P00176", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00176" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P00176", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00176" } ] } ] }, { "uniprot_ac": "P00184", "gene_name": "Cyp1a1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P00184", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00184" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "P00184", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00184" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P00184", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00184" } ] } ] }, { "uniprot_ac": "P00185", "gene_name": "Cyp1a1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P00185", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00185" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "P00185", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00185" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P00185", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00185" } ] } ] }, { "uniprot_ac": "P00186", "gene_name": "Cyp1a2", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P00186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00186" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "P00186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00186" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P00186", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00186" } ] } ] }, { "uniprot_ac": "P04167", "gene_name": "Cyp2b2", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P04167", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04167" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P04167", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04167" } ] } ] }, { "uniprot_ac": "P04798", "gene_name": "CYP1A1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P04798", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04798" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "P04798", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04798" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P04798", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04798" } ] } ] }, { "uniprot_ac": "P04799", "gene_name": "Cyp1a2", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P04799", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04799" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P04799", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04799" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "P04799", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04799" } ] } ] }, { "uniprot_ac": "P04800", "gene_name": "Cyp3a1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P04800", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04800" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P04800", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04800" } ] }, { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "P04800", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04800" } ] } ] }, { "uniprot_ac": "P05177", "gene_name": "CYP1A2", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P05177", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05177" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "P05177", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05177" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P05177", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05177" } ] } ] }, { "uniprot_ac": "P05178", "gene_name": "Cyp2c6", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P05178", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05178" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P05178", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05178" } ] } ] }, { "uniprot_ac": "P05179", "gene_name": "Cyp2c7", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P05179", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05179" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P05179", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05179" } ] } ] }, { "uniprot_ac": "P05181", "gene_name": "CYP2E1", "activity": [ { "ec_number": "1.14.13.n7", "activity": "4-nitrophenol + H(+) + NADPH + O2 = 4-nitrocatechol + H2O + NADP(+).", "evidence": [ { "id": "P05181", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05181" } ] }, { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P05181", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05181" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P05181", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05181" } ] }, { "ec_number": "1.14.13.n7", "activity": "", "evidence": [ { "id": "P05181", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05181" } ] } ] }, { "uniprot_ac": "P05182", "gene_name": "Cyp2e1", "activity": [ { "ec_number": "1.14.13.n7", "activity": "4-nitrophenol + H(+) + NADPH + O2 = 4-nitrocatechol + H2O + NADP(+).", "evidence": [ { "id": "P05182", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05182" } ] }, { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P05182", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05182" } ] }, { "ec_number": "1.14.13.n7", "activity": "", "evidence": [ { "id": "P05182", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05182" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P05182", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05182" } ] } ] }, { "uniprot_ac": "P05183", "gene_name": "Cyp3a2", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P05183", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05183" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P05183", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05183" } ] } ] }, { "uniprot_ac": "P08683", "gene_name": "Cyp2c11", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P08683", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08683" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P08683", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08683" } ] } ] }, { "uniprot_ac": "P08684", "gene_name": "CYP3A4", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P08684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08684" } ] }, { "ec_number": "1.14.14.55", "activity": "O2 + quinine + reduced [NADPH--hemoprotein reductase] = 3-hydroxyquinine + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P08684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08684" } ] }, { "ec_number": "1.14.14.56", "activity": "1,8-cineole + O2 + reduced [NADPH--hemoprotein reductase] = 2-exo-hydroxy-1,8-cineole + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P08684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08684" } ] }, { "ec_number": "1.14.14.73", "activity": "albendazole + O2 + reduced [NADPH--hemoprotein reductase] = albendazole S-oxide + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P08684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08684" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P08684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08684" } ] }, { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "P08684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08684" } ] } ] }, { "uniprot_ac": "P10610", "gene_name": "Cyp2g1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P10610", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10610" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P10610", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10610" } ] } ] }, { "uniprot_ac": "P10632", "gene_name": "CYP2C8", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P10632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10632" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P10632", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10632" } ] } ] }, { "uniprot_ac": "P10633", "gene_name": "Cyp2d1", "activity": [ { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "P10633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10633" } ] }, { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P10633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10633" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P10633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10633" } ] } ] }, { "uniprot_ac": "P10634", "gene_name": "Cyp2d26", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P10634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10634" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P10634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10634" } ] } ] }, { "uniprot_ac": "P11510", "gene_name": "Cyp2c12", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P11510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11510" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P11510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11510" } ] } ] }, { "uniprot_ac": "P11711", "gene_name": "Cyp2a1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P11711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11711" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P11711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11711" } ] } ] }, { "uniprot_ac": "P11712", "gene_name": "CYP2C9", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P11712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11712" } ] }, { "ec_number": "1.14.14.51", "activity": "(4S)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (1S,5R)-carveol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P11712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11712" } ] }, { "ec_number": "1.14.14.52", "activity": "(4S)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (4S)-perillyl alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P11712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11712" } ] }, { "ec_number": "1.14.14.53", "activity": "(4R)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (1R,5S)-carveol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P11712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11712" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P11712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11712" } ] } ] }, { "uniprot_ac": "P11714", "gene_name": "Cyp2d9", "activity": [ { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "P11714", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11714" } ] }, { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P11714", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11714" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P11714", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11714" } ] } ] }, { "uniprot_ac": "P12790", "gene_name": "Cyp2b9", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P12790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12790" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P12790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12790" } ] } ] }, { "uniprot_ac": "P12791", "gene_name": "Cyp2b10", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P12791", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12791" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P12791", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12791" } ] } ] }, { "uniprot_ac": "P12938", "gene_name": "Cyp2d3", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P12938", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12938" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P12938", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12938" } ] } ] }, { "uniprot_ac": "P12939", "gene_name": "Cyp2d10", "activity": [ { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "P12939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12939" } ] }, { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P12939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12939" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P12939", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12939" } ] } ] }, { "uniprot_ac": "P13107", "gene_name": "Cyp2b3", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P13107", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13107" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P13107", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13107" } ] } ] }, { "uniprot_ac": "P13584", "gene_name": "CYP4B1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P13584", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13584" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P13584", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13584" } ] } ] }, { "uniprot_ac": "P15129", "gene_name": "Cyp4b1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P15129", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15129" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P15129", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15129" } ] } ] }, { "uniprot_ac": "P15149", "gene_name": "Cyp2a2", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P15149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15149" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P15149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15149" } ] } ] }, { "uniprot_ac": "P15392", "gene_name": "Cyp2a4", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P15392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15392" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P15392", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15392" } ] } ] }, { "uniprot_ac": "P20812", "gene_name": "Cyp2a3", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P20812", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20812" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P20812", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20812" } ] } ] }, { "uniprot_ac": "P20814", "gene_name": "Cyp2c13", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P20814", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20814" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P20814", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20814" } ] } ] }, { "uniprot_ac": "P20815", "gene_name": "CYP3A5", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P20815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20815" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P20815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20815" } ] } ] }, { "uniprot_ac": "P20852", "gene_name": "Cyp2a5", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P20852", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20852" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P20852", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20852" } ] } ] }, { "uniprot_ac": "P20853", "gene_name": "CYP2A7", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P20853", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20853" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P20853", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20853" } ] } ] }, { "uniprot_ac": "P24456", "gene_name": "Cyp2d10", "activity": [ { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "P24456", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24456" } ] }, { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P24456", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24456" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P24456", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24456" } ] } ] }, { "uniprot_ac": "P24457", "gene_name": "Cyp2d11", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P24457", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24457" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P24457", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24457" } ] } ] }, { "uniprot_ac": "P24462", "gene_name": "CYP3A7", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P24462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24462" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P24462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24462" } ] } ] }, { "uniprot_ac": "P24464", "gene_name": "Cyp4a12", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P24464", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24464" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P24464", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24464" } ] } ] }, { "uniprot_ac": "P24903", "gene_name": "CYP2F1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P24903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24903" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P24903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24903" } ] } ] }, { "uniprot_ac": "P33260", "gene_name": "CYP2C18", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P33260", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33260" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P33260", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33260" } ] } ] }, { "uniprot_ac": "P33261", "gene_name": "CYP2C19", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P33261", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33261" } ] }, { "ec_number": "1.14.14.51", "activity": "(4S)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (1S,5R)-carveol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P33261", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33261" } ] }, { "ec_number": "1.14.14.52", "activity": "(4S)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (4S)-perillyl alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P33261", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33261" } ] }, { "ec_number": "1.14.14.53", "activity": "(4R)-limonene + O2 + reduced [NADPH--hemoprotein reductase] = (1R,5S)-carveol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P33261", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33261" } ] }, { "ec_number": "1.14.14.75", "activity": "fenbendazole + O2 + reduced [NADPH--hemoprotein reductase] = 4'-hydroxyfenbendazole + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P33261", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33261" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P33261", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33261" } ] } ] }, { "uniprot_ac": "P33272", "gene_name": "Cyp2b12", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P33272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33272" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P33272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33272" } ] } ] }, { "uniprot_ac": "P33273", "gene_name": "Cyp2c55", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P33273", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33273" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P33273", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33273" } ] } ] }, { "uniprot_ac": "P51538", "gene_name": "Cyp3a9", "activity": [ { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "P51538", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51538" } ] }, { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P51538", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51538" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P51538", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51538" } ] } ] }, { "uniprot_ac": "P51590", "gene_name": "Cyp2j3", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P51590", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51590" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P51590", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51590" } ] } ] }, { "uniprot_ac": "P51870", "gene_name": "Cyp4f5", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P51870", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51870" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P51870", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51870" } ] } ] }, { "uniprot_ac": "P51871", "gene_name": "Cyp4f6", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P51871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51871" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P51871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51871" } ] } ] }, { "uniprot_ac": "P56593", "gene_name": "Cyp2a12", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P56593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56593" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P56593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56593" } ] } ] }, { "uniprot_ac": "P56654", "gene_name": "Cyp2c37", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P56654", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56654" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P56654", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56654" } ] } ] }, { "uniprot_ac": "P56655", "gene_name": "Cyp2c38", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P56655", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56655" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P56655", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56655" } ] } ] }, { "uniprot_ac": "P56656", "gene_name": "Cyp2c39", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P56656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56656" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P56656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56656" } ] } ] }, { "uniprot_ac": "P78329", "gene_name": "CYP4F2", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] }, { "ec_number": "1.14.14.78", "activity": "O2 + phylloquinone + reduced [NADPH--hemoprotein reductase] = H(+) + H2O + omega-hydroxyphylloquinone + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] }, { "ec_number": "1.14.14.79", "activity": "(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 + reduced [NADPH--hemoprotein reductase] = 22-hydroxy-(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] }, { "ec_number": "1.14.14.94", "activity": "leukotriene B4 + O2 + reduced [NADPH--hemoprotein reductase] = 20-hydroxy-leukotriene B4 + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] } ] }, { "uniprot_ac": "P98187", "gene_name": "CYP4F8", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P98187", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98187" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P98187", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98187" } ] } ] }, { "uniprot_ac": "Q02928", "gene_name": "CYP4A11", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q02928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02928" } ] }, { "ec_number": "1.14.14.80", "activity": "O2 + octadecanoate + reduced [NADPH--hemoprotein reductase] = 18-hydroxyoctadecanoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q02928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02928" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q02928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02928" } ] } ] }, { "uniprot_ac": "Q05421", "gene_name": "Cyp2e1", "activity": [ { "ec_number": "1.14.13.n7", "activity": "4-nitrophenol + H(+) + NADPH + O2 = 4-nitrocatechol + H2O + NADP(+).", "evidence": [ { "id": "Q05421", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05421" } ] }, { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q05421", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05421" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q05421", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05421" } ] }, { "ec_number": "1.14.13.n7", "activity": "", "evidence": [ { "id": "Q05421", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05421" } ] } ] }, { "uniprot_ac": "Q08477", "gene_name": "CYP4F3", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q08477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08477" } ] }, { "ec_number": "1.14.14.79", "activity": "(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 + reduced [NADPH--hemoprotein reductase] = 22-hydroxy-(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q08477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08477" } ] }, { "ec_number": "1.14.14.94", "activity": "leukotriene B4 + O2 + reduced [NADPH--hemoprotein reductase] = 20-hydroxy-leukotriene B4 + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q08477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08477" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q08477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08477" } ] } ] }, { "uniprot_ac": "Q16678", "gene_name": "CYP1B1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q16678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16678" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "Q16678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16678" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q16678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16678" } ] } ] }, { "uniprot_ac": "Q16696", "gene_name": "CYP2A13", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q16696", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16696" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q16696", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16696" } ] } ] }, { "uniprot_ac": "Q64429", "gene_name": "Cyp1b1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q64429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64429" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "Q64429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64429" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q64429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64429" } ] } ] }, { "uniprot_ac": "Q64458", "gene_name": "Cyp2c29", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q64458", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64458" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q64458", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64458" } ] } ] }, { "uniprot_ac": "Q64459", "gene_name": "Cyp3a11", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q64459", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64459" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q64459", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64459" } ] } ] }, { "uniprot_ac": "Q64462", "gene_name": "Cyp4b1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q64462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64462" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q64462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64462" } ] } ] }, { "uniprot_ac": "Q64464", "gene_name": "Cyp3a13", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q64464", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64464" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q64464", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64464" } ] } ] }, { "uniprot_ac": "Q64481", "gene_name": "Cyp3a16", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q64481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64481" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q64481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64481" } ] } ] }, { "uniprot_ac": "Q64581", "gene_name": "Cyp3a18", "activity": [ { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "Q64581", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64581" } ] }, { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q64581", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64581" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q64581", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64581" } ] } ] }, { "uniprot_ac": "Q64583", "gene_name": "Cyp2b15", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q64583", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64583" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q64583", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64583" } ] } ] }, { "uniprot_ac": "Q64678", "gene_name": "Cyp1b1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q64678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64678" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "Q64678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64678" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q64678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64678" } ] } ] }, { "uniprot_ac": "Q64680", "gene_name": "Cyp2d4", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q64680", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64680" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q64680", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64680" } ] } ] }, { "uniprot_ac": "Q6V0L0", "gene_name": "CYP26C1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q6V0L0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6V0L0" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q6V0L0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6V0L0" } ] } ] }, { "uniprot_ac": "Q6XVG2", "gene_name": "Cyp2c54", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q6XVG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XVG2" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q6XVG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6XVG2" } ] } ] }, { "uniprot_ac": "Q86W10", "gene_name": "CYP4Z1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q86W10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86W10" } ] }, { "ec_number": "1.14.14.130", "activity": "dodecanoate + O2 + reduced [NADPH--hemoprotein reductase] = 7-hydroxydodecanoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q86W10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86W10" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q86W10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86W10" } ] } ] }, { "uniprot_ac": "Q8CIM7", "gene_name": "Cyp2d26", "activity": [ { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "Q8CIM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIM7" } ] }, { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q8CIM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIM7" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q8CIM7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CIM7" } ] } ] }, { "uniprot_ac": "Q91WL5", "gene_name": "Cyp4a12a", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q91WL5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WL5" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q91WL5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WL5" } ] } ] }, { "uniprot_ac": "Q91X77", "gene_name": "Cyp2c50", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q91X77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91X77" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q91X77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91X77" } ] } ] }, { "uniprot_ac": "Q9D816", "gene_name": "Cyp2c55", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q9D816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D816" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q9D816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D816" } ] } ] }, { "uniprot_ac": "Q9DBX6", "gene_name": "Cyp2s1", "activity": [ { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "Q9DBX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBX6" } ] }, { "ec_number": "4.2.1.152", "activity": "(12R)-hydroperoxy-(5Z,8Z,10E,14Z)-eicosatetraenoate = 12-oxo-(5Z,8Z,10E,14Z)-eicosatetraenoate + H2O.", "evidence": [ { "id": "Q9DBX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBX6" } ] }, { "ec_number": "5.3.99.5", "activity": "prostaglandin H2 = thromboxane A2.", "evidence": [ { "id": "Q9DBX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBX6" } ] }, { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q9DBX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBX6" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q9DBX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBX6" } ] } ] }, { "uniprot_ac": "Q9EQW4", "gene_name": "Cyp3a44", "activity": [ { "ec_number": "1.14.14.-", "activity": "", "evidence": [ { "id": "Q9EQW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EQW4" } ] } ] }, { "uniprot_ac": "Q9HB55", "gene_name": "CYP3A43", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q9HB55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HB55" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q9HB55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HB55" } ] } ] }, { "uniprot_ac": "Q9HBI6", "gene_name": "CYP4F11", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q9HBI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBI6" } ] }, { "ec_number": "1.14.14.80", "activity": "O2 + octadecanoate + reduced [NADPH--hemoprotein reductase] = 18-hydroxyoctadecanoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q9HBI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBI6" } ] }, { "ec_number": "1.14.14.78", "activity": "O2 + phylloquinone + reduced [NADPH--hemoprotein reductase] = H(+) + H2O + omega-hydroxyphylloquinone + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q9HBI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBI6" } ] }, { "ec_number": "1.14.14.79", "activity": "(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 + reduced [NADPH--hemoprotein reductase] = 22-hydroxy-(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q9HBI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBI6" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q9HBI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBI6" } ] } ] }, { "uniprot_ac": "Q9HCS2", "gene_name": "CYP4F12", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q9HCS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCS2" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q9HCS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HCS2" } ] } ] }, { "uniprot_ac": "Q9JMA7", "gene_name": "Cyp3a41a", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q9JMA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JMA7" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q9JMA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JMA7" } ] } ] }, { "uniprot_ac": "Q9QXF7", "gene_name": "CYP2J4", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q9QXF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXF7" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q9QXF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXF7" } ] } ] }, { "uniprot_ac": "Q9WV19", "gene_name": "Cyp2g1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q9WV19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV19" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q9WV19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV19" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }