{ "uniprot_canonical_ac": "A0A0G2K5G5-1", "uniprot_ac": "A0A0G2K5G5", "uniprot_id": "A0A0G2K5G5_RAT", "mass": { "chemical_mass": 32214.0, "monoisotopic_mass": 32214.0 }, "refseq": { "ac": "XP_006249560", "name": "DNA oxidative demethylase ALKBH2 isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006249560" }, "gene_names": [ { "name": "Alkbh2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5", "id": "A0A0G2K5G5" }, { "name": "Alkbh2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006249560", "id": "XP_006249560" }, { "name": "RGD1306377", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006249560", "id": "XP_006249560" } ], "protein_names": [ { "name": "AlkB homolog 2, alpha-ketoglutarate-dependent dioxygenase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K5G5" }, { "name": "DNA oxidative demethylase ALKBH2 isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006249560", "id": "XP_006249560" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5G5", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5" } ], "common_name": "Rat" } ], "gene": [ { "name": "Alkbh2", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5", "locus": { "chromosome": "12", "start_pos": 42500914, "end_pos": 42496300, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000028584", "url": "https://www.ensembl.org/id/ENSRNOG00000028584" } ] } } ], "crossref": [ { "id": "ENSRNOG00000028584", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000028584", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "304578", "url": "https://www.ncbi.nlm.nih.gov/gene/304578", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR005123", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005123", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027450", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027450", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032852", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032852", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037151", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037151", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "TQHHWQH", "url": "https://omabrowser.org/oma/group/TQHHWQH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5483680at2759", "url": "http://www.orthodb.org/?query=5483680at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR31573", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31573", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR31573:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31573:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13532", "url": "http://pfam.xfam.org/family/PF13532", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_006249560", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006249560", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1306377", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1306377", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K5G5", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K5G5-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCRALARVAAPDPPVEHGCVPVLAYPAGRRTEAPCFSGTRLWLAGGGGMDRFLVRPDRGDIQGAAEEPAPTGEASGDMQSPGWQHFRAEGLNCDYTVLFRKAEADQIFRELEQEVEYFTGALAKVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLTPKPWIPVLERVRDQVCRVTGQTFNFVLVNRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDILFRHKDSRGKRPRRAVEVVRLQLAHGSLLMMNHPTNTHWYHSLPIRKRVLAPRINLTFRKILPTKK", "length": 287, "header": "tr|A0A0G2K5G5-1|A0A0G2K5G5_RAT Isoform 1 of AlkB homolog 2, alpha-ketoglutarate-dependent dioxygenase OS=Rattus norvegicus OX=10116 GN=Alkbh2 PE=4 SV=1 CANONICAL=A0A0G2K5G5-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K5G5-1", "url": "", "sequence": { "sequence": "MCRALARVAAPDPPVEHGCVPVLAYPAGRRTEAPCFSGTRLWLAGGGGMDRFLVRPDRGDIQGAAEEPAPTGEASGDMQSPGWQHFRAEGLNCDYTVLFRKAEADQIFRELEQEVEYFTGALAKVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLTPKPWIPVLERVRDQVCRVTGQTFNFVLVNRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDILFRHKDSRGKRPRRAVEVVRLQLAHGSLLMMNHPTNTHWYHSLPIRKRVLAPRINLTFRKILPTKK", "length": 287, "header": "tr|A0A0G2K5G5-1|A0A0G2K5G5_RAT Isoform 1 of AlkB homolog 2, alpha-ketoglutarate-dependent dioxygenase OS=Rattus norvegicus OX=10116 GN=Alkbh2 PE=4 SV=1 CANONICAL=A0A0G2K5G5-1" }, "locus": { "chromosome": "12", "start_pos": 42500905, "end_pos": 42496334, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000090277.2", "url": "https://www.ensembl.org/id/ENSRNOT00000090277.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000073418.1", "url": "https://www.ensembl.org/id/ENSRNOP00000073418.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "Q6NS38-1", "protein_name": "DNA oxidative demethylase ALKBH2", "gene_name": "ALKBH2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLTKK", "length": 261 }, "evidence": [ { "id": "45240121", "url": "http://www.informatics.jax.org/homology/45240121", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q6P6J4-1", "protein_name": "DNA oxidative demethylase ALKBH2", "gene_name": "Alkbh2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDKFLVRPDLRDLQGGGEEPAPTGGASGDLKSPDWRHLRAEGLSCDYTVLFGKAEADKIFRELEQEVEYFTGALAKVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLTPKPWVPVLERVRDRVCEVTGQTFNFVLVNRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFIFRHKDSRGKRPRRTVEVVRLQLAHGSLLMMNPPTNTHWYHSLPIRKRVLAPRVNLTFRKILPTKK", "length": 239 }, "evidence": [ { "id": "45240121", "url": "http://www.informatics.jax.org/homology/45240121", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5G5", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5G5", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5G5", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "DNA dealkylation involved in DNA repair", "id": "GO:0006307", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006307", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5G5", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "ferrous iron binding", "id": "GO:0008198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008198", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5G5", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5" } ], "pmid": "" }, { "name": "2-oxoglutarate-dependent dioxygenase activity", "id": "GO:0016706", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016706", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5G5", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5" } ], "pmid": "" }, { "name": "DNA-N1-methyladenine dioxygenase activity", "id": "GO:0043734", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043734", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5G5", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5" } ], "pmid": "" }, { "name": "cytosine C-5 DNA demethylase activity", "id": "GO:0051747", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051747", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5G5", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5" } ], "pmid": "" }, { "name": "rDNA binding", "id": "GO:0000182", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000182", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5G5", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5" } ], "pmid": "" }, { "name": "oxidative DNA demethylase activity", "id": "GO:0035516", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035516", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5G5", "url": "https://www.uniprot.org/uniprot/A0A0G2K5G5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 276, "end_pos": 278, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }