{ "uniprot_canonical_ac": "A0A0G2K5F7-1", "uniprot_ac": "A0A0G2K5F7", "uniprot_id": "A0A0G2K5F7_RAT", "mass": { "chemical_mass": 17520.0, "monoisotopic_mass": 17520.0 }, "refseq": { "ac": "XP_006249153", "name": "zinc finger HIT domain-containing protein 1 isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006249153" }, "gene_names": [ { "name": "Znhit1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7", "id": "A0A0G2K5F7" }, { "name": "Znhit1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006249153", "id": "XP_006249153" } ], "protein_names": [ { "name": "Zinc finger, HIT-type containing 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K5F7" }, { "name": "zinc finger HIT domain-containing protein 1 isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006249153", "id": "XP_006249153" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "common_name": "Rat" } ], "gene": [ { "name": "Znhit1", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7", "locus": { "chromosome": "12", "start_pos": 19692880, "end_pos": 19686148, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000001418", "url": "https://www.ensembl.org/id/ENSRNOG00000001418" } ] } } ], "crossref": [ { "id": "ENSRNOG00000001418", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000001418", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "100360077", "url": "https://www.ncbi.nlm.nih.gov/gene/100360077", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR007529", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007529", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039723", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039723", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:100360077", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:100360077", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CIPCGAR", "url": "https://omabrowser.org/oma/group/CIPCGAR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2029831at2759", "url": "http://www.orthodb.org/?query=2029831at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13093", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13093", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13093:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13093:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04438", "url": "http://pfam.xfam.org/family/PF04438", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_006249153", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006249153", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "2322870", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2322870", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K5F7-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZNG9", "url": "https://www.uniprot.org/uniprot/D3ZNG9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZNG9-1", "url": "https://www.uniprot.org/uniprot/D3ZNG9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVEKKPSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSASEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV", "length": 154, "header": "tr|A0A0G2K5F7-1|A0A0G2K5F7_RAT Isoform 1 of Zinc finger, HIT-type containing 1 OS=Rattus norvegicus OX=10116 GN=Znhit1 PE=4 SV=2 CANONICAL=A0A0G2K5F7-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K5F7-1", "url": "", "sequence": { "sequence": "MVEKKPSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSASEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV", "length": 154, "header": "tr|A0A0G2K5F7-1|A0A0G2K5F7_RAT Isoform 1 of Zinc finger, HIT-type containing 1 OS=Rattus norvegicus OX=10116 GN=Znhit1 PE=4 SV=2 CANONICAL=A0A0G2K5F7-1" }, "locus": { "chromosome": "12", "start_pos": 19692677, "end_pos": 19687511, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000077293.2", "url": "https://www.ensembl.org/id/ENSRNOT00000077293.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000073409.2", "url": "https://www.ensembl.org/id/ENSRNOP00000073409.2" } ] } }, { "isoform_ac": "D3ZNG9-1", "url": "", "sequence": { "sequence": "SQHEGLKQASQAGRKRVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSASEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV", "length": 163, "header": "tr|D3ZNG9-1|A0A0G2K5F7_RAT Computationally mapped isoform of Zinc finger, HIT-type containing 1 OS=Rattus norvegicus OX=10116 GN=Znhit1 PE=4 SV=4 CANONICAL=A0A0G2K5F7-1" }, "locus": { "chromosome": "12", "start_pos": 19692677, "end_pos": 19689498, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000040015.6", "url": "https://www.ensembl.org/id/ENSRNOT00000040015.6" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000039507.6", "url": "https://www.ensembl.org/id/ENSRNOP00000039507.6" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:100360077", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:100360077", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O43257-1", "protein_name": "Zinc finger HIT domain-containing protein 1", "gene_name": "ZNHIT1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV", "length": 154 }, "evidence": [ { "id": "45233578", "url": "http://www.informatics.jax.org/homology/45233578", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8R331-1", "protein_name": "Zinc finger HIT domain-containing protein 1", "gene_name": "Znhit1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVEKKPAVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSASEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV", "length": 154 }, "evidence": [ { "id": "45233578", "url": "http://www.informatics.jax.org/homology/45233578", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 13, "go_terms": [ { "name": "positive regulation of transcription initiation by RNA polymerase II", "id": "GO:0060261", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060261", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "chromatin remodeling", "id": "GO:0006338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006338", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "negative regulation of G0 to G1 transition", "id": "GO:0070317", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070317", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "transcription initiation-coupled chromatin remodeling", "id": "GO:0045815", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045815", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "calcium ion homeostasis", "id": "GO:0055074", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055074", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "muscle cell differentiation", "id": "GO:0042692", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042692", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "hematopoietic stem cell homeostasis", "id": "GO:0061484", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061484", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "regulation of T cell proliferation", "id": "GO:0042129", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042129", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "intestinal stem cell homeostasis", "id": "GO:0036335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036335", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "positive regulation of DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator", "id": "GO:1902164", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902164", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "heart process", "id": "GO:0003015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003015", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "positive regulation of lymphoid progenitor cell differentiation", "id": "GO:1905458", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905458", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "histone deacetylase binding", "id": "GO:0042826", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042826", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "histone binding", "id": "GO:0042393", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042393", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "nucleosome binding", "id": "GO:0031491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031491", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" }, { "name": "Swr1 complex", "id": "GO:0000812", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000812", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K5F7", "url": "https://www.uniprot.org/uniprot/A0A0G2K5F7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 92, "end_pos": 94, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }