{ "uniprot_canonical_ac": "A0A0G2K3R4-1", "uniprot_ac": "A0A0G2K3R4", "uniprot_id": "A0A0G2K3R4_RAT", "mass": { "chemical_mass": 25446.0, "monoisotopic_mass": 25446.0 }, "refseq": { "ac": "NP_001032435", "name": "rhombotin-2 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032435" }, "gene_names": [ { "name": "Lmo2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4", "id": "A0A0G2K3R4" }, { "name": "Lmo2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032435", "id": "NP_001032435" } ], "protein_names": [ { "name": "LIM domain only 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K3R4" }, { "name": "rhombotin-2 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032435", "id": "NP_001032435" }, { "name": "rhombotin-2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001032435", "id": "NP_001032435" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "common_name": "Rat" } ], "gene": [ { "name": "Lmo2", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4", "locus": { "chromosome": "3", "start_pos": 90377953, "end_pos": 90365883, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000009401", "url": "https://www.ensembl.org/id/ENSRNOG00000009401" } ] } } ], "crossref": [ { "id": "ENSRNOG00000009401", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000009401", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd09384", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09384", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd09385", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09385", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "362176", "url": "https://www.ncbi.nlm.nih.gov/gene/362176", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001781", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001781", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:362176", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:362176", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MCGGCQQ", "url": "https://omabrowser.org/oma/group/MCGGCQQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2875464at2759", "url": "http://www.orthodb.org/?query=2875464at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45787", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45787", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45787:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45787:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00412", "url": "http://pfam.xfam.org/family/PF00412", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8939236", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8939236", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "1307101", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1307101", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K3R4-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2KAY6", "url": "https://www.uniprot.org/uniprot/A0A0G2KAY6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2KAY6-1", "url": "https://www.uniprot.org/uniprot/A0A0G2KAY6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2QC60", "url": "https://www.uniprot.org/uniprot/A0A0G2QC60", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2QC60-1", "url": "https://www.uniprot.org/uniprot/A0A0G2QC60-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "VIRSLSLAFEGSAVTVLERGGASSPAERPSKRRRRSGGARAPEGVRVQAASQPRATKGAPPPPGTPPPSPMSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGII", "length": 228, "header": "tr|A0A0G2K3R4-1|A0A0G2K3R4_RAT Isoform 1 of LIM domain only 2 OS=Rattus norvegicus OX=10116 GN=Lmo2 PE=4 SV=1 CANONICAL=A0A0G2K3R4-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K3R4-1", "url": "", "sequence": { "sequence": "VIRSLSLAFEGSAVTVLERGGASSPAERPSKRRRRSGGARAPEGVRVQAASQPRATKGAPPPPGTPPPSPMSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGII", "length": 228, "header": "tr|A0A0G2K3R4-1|A0A0G2K3R4_RAT Isoform 1 of LIM domain only 2 OS=Rattus norvegicus OX=10116 GN=Lmo2 PE=4 SV=1 CANONICAL=A0A0G2K3R4-1" }, "locus": { "chromosome": "3", "start_pos": 90377212, "end_pos": 90366852, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000090365.2", "url": "https://www.ensembl.org/id/ENSRNOT00000090365.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000072744.2", "url": "https://www.ensembl.org/id/ENSRNOP00000072744.2" } ] } }, { "isoform_ac": "A0A0G2KAY6-1", "url": "", "sequence": { "sequence": "MSPLSMALEREPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGII", "length": 154, "header": "tr|A0A0G2KAY6-1|A0A0G2KAY6_RAT Computationally mapped isoform of LIM domain only 2 OS=Rattus norvegicus OX=10116 GN=Lmo2 PE=4 SV=1 CANONICAL=A0A0G2K3R4-1" }, "locus": { "chromosome": "3", "start_pos": 90377212, "end_pos": 90371634, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000083527.2", "url": "https://www.ensembl.org/id/ENSRNOT00000083527.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000075577.2", "url": "https://www.ensembl.org/id/ENSRNOP00000075577.2" } ] } }, { "isoform_ac": "A0A0G2QC60-1", "url": "", "sequence": { "sequence": "MEGSAVTVLERGGASSPAERPSKRRRRSGGARAPEGVRVQAASQPRATKGAPPPPGTPPPSPMSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGII", "length": 220, "header": "tr|A0A0G2QC60-1|A0A0G2K3R4_RAT Computationally mapped isoform of LIM domain only 2 OS=Rattus norvegicus OX=10116 GN=Lmo2 PE=4 SV=1 CANONICAL=A0A0G2K3R4-1" }, "locus": { "chromosome": "3", "start_pos": 90377212, "end_pos": 90366749, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000012625.7", "url": "https://www.ensembl.org/id/ENSRNOT00000012625.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000012625.7", "url": "https://www.ensembl.org/id/ENSRNOP00000012625.7" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:362176", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:362176", "resource": "KEGG Pathway" }, { "id": "R-RNO-8939236", "name": "RUNX1 regulates transcription of genes involved in differentiation of HSCs", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8939236", "resource": "Reactome", "description": "RUNX1 regulates transcription of genes involved in differentiation of HSCs" } ], "orthologs": [ { "uniprot_canonical_ac": "P25791-1", "protein_name": "Rhombotin-2", "gene_name": "LMO2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI", "length": 158 }, "evidence": [ { "id": "45224831", "url": "http://www.informatics.jax.org/homology/45224831", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P25801-1", "protein_name": "Rhombotin-2", "gene_name": "Lmo2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGII", "length": 158 }, "evidence": [ { "id": "45224831", "url": "http://www.informatics.jax.org/homology/45224831", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "embryonic hemopoiesis", "id": "GO:0035162", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035162", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "pmid": "" }, { "name": "cellular response to thyroid hormone stimulus", "id": "GO:0097067", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097067", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "pmid": "" }, { "name": "negative regulation of erythrocyte differentiation", "id": "GO:0045647", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045647", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "pmid": "" }, { "name": "transcription coactivator activity", "id": "GO:0003713", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003713", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "pmid": "" }, { "name": "bHLH transcription factor binding", "id": "GO:0043425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043425", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "pmid": "" }, { "name": "transcription coregulator binding", "id": "GO:0001221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001221", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "pmid": "" }, { "name": "DNA-binding transcription factor binding", "id": "GO:0140297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140297", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "pmid": "" }, { "name": "transcription regulator complex", "id": "GO:0005667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3R4", "url": "https://www.uniprot.org/uniprot/A0A0G2K3R4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }