{ "uniprot_canonical_ac": "A0A0G2K3F6-1", "uniprot_ac": "A0A0G2K3F6", "uniprot_id": "A0A0G2K3F6_RAT", "mass": { "chemical_mass": 22521.0, "monoisotopic_mass": 22521.0 }, "refseq": {}, "gene_names": [ { "name": "Ap5s1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K3F6", "id": "A0A0G2K3F6" } ], "protein_names": [ { "name": "Adaptor related protein complex 5 subunit sigma 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K3F6" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K3F6" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ap5s1", "url": "https://www.uniprot.org/uniprot/A0A0G2K3F6", "locus": { "chromosome": "3", "start_pos": 118432926, "end_pos": 118429637, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000021249", "url": "https://www.ensembl.org/id/ENSRNOG00000021249" } ] } } ], "crossref": [ { "id": "ENSRNOG00000021249", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000021249", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "499893", "url": "https://www.ncbi.nlm.nih.gov/gene/499893", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR029392", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029392", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:499893", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:499893", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HGQMLFL", "url": "https://omabrowser.org/oma/group/HGQMLFL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "9223at2759", "url": "http://www.orthodb.org/?query=9223at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR16120", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16120", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16120:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16120:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15001", "url": "http://pfam.xfam.org/family/PF15001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_006235100", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006235100", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1561852", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1561852", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K3F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K3F6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K3F6-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K3F6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AEB8", "url": "https://www.uniprot.org/uniprot/A0A8I6AEB8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AEB8-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AEB8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZGQ9", "url": "https://www.uniprot.org/uniprot/D3ZGQ9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3ZGQ9-1", "url": "https://www.uniprot.org/uniprot/D3ZGQ9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVHAFLIHTLRAPNLEDTGLCRVLYSCVFGAEKSPDDPRPHGAERDRLFRKEQILAVARQVESLCRLQQQASGCSSTDPQPQFSAESVSLHEAPHGAFHLAAGDPFQEPQTVLWLGVLSLGFTLVLDTHENLLLAERTLRLLARLLLDHLRLLTPGTNFLLRADRIEGILTRFLPHGQLLFLNDQFVQDLEKEFSAAWPR", "length": 200, "header": "tr|A0A0G2K3F6-1|A0A0G2K3F6_RAT Isoform 1 of Adaptor related protein complex 5 subunit sigma 1 OS=Rattus norvegicus OX=10116 GN=Ap5s1 PE=4 SV=1 CANONICAL=A0A0G2K3F6-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K3F6-1", "url": "", "sequence": { "sequence": "MVHAFLIHTLRAPNLEDTGLCRVLYSCVFGAEKSPDDPRPHGAERDRLFRKEQILAVARQVESLCRLQQQASGCSSTDPQPQFSAESVSLHEAPHGAFHLAAGDPFQEPQTVLWLGVLSLGFTLVLDTHENLLLAERTLRLLARLLLDHLRLLTPGTNFLLRADRIEGILTRFLPHGQLLFLNDQFVQDLEKEFSAAWPR", "length": 200, "header": "tr|A0A0G2K3F6-1|A0A0G2K3F6_RAT Isoform 1 of Adaptor related protein complex 5 subunit sigma 1 OS=Rattus norvegicus OX=10116 GN=Ap5s1 PE=4 SV=1 CANONICAL=A0A0G2K3F6-1" }, "locus": { "chromosome": "3", "start_pos": 118432294, "end_pos": 118430514, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000084671.2", "url": "https://www.ensembl.org/id/ENSRNOT00000084671.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000072616.1", "url": "https://www.ensembl.org/id/ENSRNOP00000072616.1" } ] } }, { "isoform_ac": "A0A8I6AEB8-1", "url": "", "sequence": { "sequence": "QKGDQRSRSANLGSLPEARLPNFLLGNFKFLVLAVFKHCISSALRPRGRHSHAAQSGQALSVYLWLTRIPVLLPPPPEGWDFRQVESLCRLQQQASGCSSTDPQPQFSAESVSLHEAPHGAFHLAAGDPFQEPQTVLWLGVLSLGFTLVLDTHENLLLAERTLRLLARLLLDHLRLLTPGTNFLLRADRIEGILTRFLPHGQLLFLNDQFVQDLEKEFSAAWPR", "length": 224, "header": "tr|A0A8I6AEB8-1|A0A0G2K3F6_RAT Computationally mapped isoform of Adaptor related protein complex 5 subunit sigma 1 OS=Rattus norvegicus OX=10116 GN=Ap5s1 PE=4 SV=1 CANONICAL=A0A0G2K3F6-1" }, "locus": { "chromosome": "3", "start_pos": 118432294, "end_pos": 118429682, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000093861.1", "url": "https://www.ensembl.org/id/ENSRNOT00000093861.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000091363.1", "url": "https://www.ensembl.org/id/ENSRNOP00000091363.1" } ] } }, { "isoform_ac": "D3ZGQ9-1", "url": "", "sequence": { "sequence": "MVHAFLIHTLRAPNLEDTGLCRVLYSCVFGAEKSPDDPRPHGAERDRLFRKEQILAVARQVESLCRLQQQASGCSSTDPQPQFSAESVSLHEAPHGAFHLAAGDPFQEPQTVLWLGVLSLGFTLVLDTHENLLLAERTLRLLARLLLDHLRLLTPAVSTGAVYCQTHLSR", "length": 170, "header": "tr|D3ZGQ9-1|D3ZGQ9_RAT Computationally mapped isoform of Adaptor related protein complex 5 subunit sigma 1 OS=Rattus norvegicus OX=10116 GN=Ap5s1 PE=4 SV=2 CANONICAL=A0A0G2K3F6-1" }, "locus": { "chromosome": "3", "start_pos": 118432641, "end_pos": 118430514, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000034201.4", "url": "https://www.ensembl.org/id/ENSRNOT00000034201.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000031548.4", "url": "https://www.ensembl.org/id/ENSRNOP00000031548.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:499893", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:499893", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9D742-1", "protein_name": "AP-5 complex subunit sigma-1", "gene_name": "Ap5s1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVHAFLIHTLRAPNLEDTGLCRVLYSCVFGAEKSPDDPRSHGAERDRLFRKEQILAVARQVESLCRLQQQAAGCSSTDLQPQFSAEPVSLHEAPHGAFHLAAGDPFQEPRTVLWLGILSLGFALVLDTHENLLLAERTLRLLARLLLDHLRLLTPAVSTGAAYCRAHPSR", "length": 170 }, "evidence": [ { "id": "45235451", "url": "http://www.informatics.jax.org/homology/45235451", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NUS5-1", "protein_name": "AP-5 complex subunit sigma-1", "gene_name": "AP5S1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVHAFLIHTLRAPNTEDTGLCRVLYSCVFGAEKSPDDPRPHGAERDRLLRKEQILAVARQVESMCRLQQQASGRPPMDLQPQSSDEQVPLHEAPRGAFRLAAENPFQEPRTVVWLGVLSLGFALVLDAHENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAWPR", "length": 200 }, "evidence": [ { "id": "45235451", "url": "http://www.informatics.jax.org/homology/45235451", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K3F6" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K3F6" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K3F6" } ], "pmid": "" }, { "name": "late endosome", "id": "GO:0005770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005770", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K3F6" } ], "pmid": "" }, { "name": "AP-type membrane coat adaptor complex", "id": "GO:0030119", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030119", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K3F6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "endosomal transport", "id": "GO:0016197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016197", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K3F6" } ], "pmid": "" }, { "name": "double-strand break repair via homologous recombination", "id": "GO:0000724", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000724", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K3F6", "url": "https://www.uniprot.org/uniprot/A0A0G2K3F6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }