{ "uniprot_canonical_ac": "A0A0G2K287-1", "uniprot_ac": "A0A0G2K287", "uniprot_id": "A0A0G2K287_RAT", "mass": { "chemical_mass": 37949.0, "monoisotopic_mass": 37949.0 }, "refseq": { "ac": "XP_017454598", "name": "LIM domain-binding protein 2 isoform X4", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017454598" }, "gene_names": [ { "name": "Ldb2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K287", "id": "A0A0G2K287" }, { "name": "Ldb2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017454598", "id": "XP_017454598" } ], "protein_names": [ { "name": "LIM domain binding 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K287" }, { "name": "LIM domain-binding protein 2 isoform X4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017454598", "id": "XP_017454598" }, { "name": "LIM domain-binding protein 2 isoform X7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017454601", "id": "XP_017454601" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ldb2", "url": "https://www.uniprot.org/uniprot/A0A0G2K287", "locus": { "chromosome": "14", "start_pos": 66597778, "end_pos": 66277085, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000003205", "url": "https://www.ensembl.org/id/ENSRNOG00000003205" } ] } } ], "crossref": [ { "id": "ENSRNOG00000003205", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000003205", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "289664", "url": "https://www.ncbi.nlm.nih.gov/gene/289664", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR029005", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029005", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "TPWNSKP", "url": "https://omabrowser.org/oma/group/TPWNSKP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1369602at2759", "url": "http://www.orthodb.org/?query=1369602at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10378", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10378", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10378:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10378:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01803", "url": "http://pfam.xfam.org/family/PF01803", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "XP_017454598", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_017454598", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1307921", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1307921", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K287-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K287-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PTQ0", "url": "https://www.uniprot.org/uniprot/E9PTQ0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PTQ0-1", "url": "https://www.uniprot.org/uniprot/E9PTQ0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCAMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNTTNSAGSKKKTTAASLSLSTQVPGLGAIPNCSLNPGRDGDLCHSTAVTPSGQFKEKH", "length": 331, "header": "tr|A0A0G2K287-1|A0A0G2K287_RAT Isoform 1 of LIM domain binding 2 OS=Rattus norvegicus OX=10116 GN=Ldb2 PE=4 SV=2 CANONICAL=A0A0G2K287-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K287-1", "url": "", "sequence": { "sequence": "MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCAMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNTTNSAGSKKKTTAASLSLSTQVPGLGAIPNCSLNPGRDGDLCHSTAVTPSGQFKEKH", "length": 331, "header": "tr|A0A0G2K287-1|A0A0G2K287_RAT Isoform 1 of LIM domain binding 2 OS=Rattus norvegicus OX=10116 GN=Ldb2 PE=4 SV=2 CANONICAL=A0A0G2K287-1" }, "locus": { "chromosome": "14", "start_pos": 66593669, "end_pos": 66277309, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000083871.2", "url": "https://www.ensembl.org/id/ENSRNOT00000083871.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000072146.2", "url": "https://www.ensembl.org/id/ENSRNOP00000072146.2" } ] } }, { "isoform_ac": "E9PTQ0-1", "url": "", "sequence": { "sequence": "MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCAMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNTTNSAGSKKKTTAASLSLSTQVPIASIARSPVSGCALRT", "length": 313, "header": "tr|E9PTQ0-1|E9PTQ0_RAT Computationally mapped isoform of LIM domain binding 2 OS=Rattus norvegicus OX=10116 GN=Ldb2 PE=4 SV=4 CANONICAL=A0A0G2K287-1" }, "locus": { "chromosome": "14", "start_pos": 66596472, "end_pos": 66277309, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000058803.4", "url": "https://www.ensembl.org/id/ENSRNOT00000058803.4" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000055594.5", "url": "https://www.ensembl.org/id/ENSRNOP00000055594.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "O43679-1", "protein_name": "LIM domain-binding protein 2", "gene_name": "LDB2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCTMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNNANSTGSKKKTTAANLSLSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQETKSENPPPQASQ", "length": 373 }, "evidence": [ { "id": "45224162", "url": "http://www.informatics.jax.org/homology/45224162", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "O55203-1", "protein_name": "LIM domain-binding protein 2", "gene_name": "Ldb2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCAMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNTTNSAGSKKKTPAASLSLATQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQETKSENAPPQASQ", "length": 373 }, "evidence": [ { "id": "45224162", "url": "http://www.informatics.jax.org/homology/45224162", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "nervous system development", "id": "GO:0007399", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007399", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "regulation of cell migration", "id": "GO:0030334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030334", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "hair follicle development", "id": "GO:0001942", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001942", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "somatic stem cell population maintenance", "id": "GO:0035019", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035019", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "epithelial structure maintenance", "id": "GO:0010669", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010669", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "regulation of kinase activity", "id": "GO:0043549", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043549", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "positive regulation of cellular component biogenesis", "id": "GO:0044089", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044089", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "cellular component biogenesis", "id": "GO:0044085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044085", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "cell leading edge", "id": "GO:0031252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031252", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "transcription regulator complex", "id": "GO:0005667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" }, { "name": "LIM domain binding", "id": "GO:0030274", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030274", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K287", "url": "https://www.uniprot.org/uniprot/A0A0G2K287" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 113, "end_pos": 115, "annotation": "n_glycosylation_sequon" }, { "start_pos": 190, "end_pos": 192, "annotation": "n_glycosylation_sequon" }, { "start_pos": 198, "end_pos": 200, "annotation": "n_glycosylation_sequon" }, { "start_pos": 224, "end_pos": 226, "annotation": "n_glycosylation_sequon" }, { "start_pos": 262, "end_pos": 264, "annotation": "n_glycosylation_sequon" }, { "start_pos": 269, "end_pos": 271, "annotation": "n_glycosylation_sequon" }, { "start_pos": 274, "end_pos": 276, "annotation": "n_glycosylation_sequon" }, { "start_pos": 304, "end_pos": 306, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }