{ "uniprot_canonical_ac": "A0A0G2K273-1", "uniprot_ac": "A0A0G2K273", "uniprot_id": "A0A0G2K273_RAT", "mass": { "chemical_mass": 52229.0, "monoisotopic_mass": 52229.0 }, "refseq": {}, "gene_names": [ { "name": "LOC100365062", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K273", "id": "A0A0G2K273" }, { "name": "EIF3E", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2K273", "id": "A0A0G2K273" }, { "name": "EIF3S6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2K273", "id": "A0A0G2K273" }, { "name": "INT6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2K273", "id": "A0A0G2K273" } ], "protein_names": [ { "name": "Eukaryotic translation initiation factor 3 subunit E", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0G2K273" }, { "name": "Eukaryotic translation initiation factor 3 subunit 6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K273" }, { "name": "eIF-3 p48", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K273" }, { "name": "eIF3e", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K273" } ], "function": [ { "annotation": "Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. Required for nonsense-mediated mRNA decay (NMD); may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. May interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K273", "url": "https://www.uniprot.org/uniprot/A0A0G2K273#function" }, { "database": "UniProtKB", "id": "MF_03004", "url": "https://www.uniprot.org/uniprot/MF_03004#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K273", "url": "https://www.uniprot.org/uniprot/A0A0G2K273" } ], "common_name": "Rat" } ], "gene": [ { "name": "LOC100365062", "url": "https://www.uniprot.org/uniprot/A0A0G2K273", "locus": { "chromosome": "1", "start_pos": 73776003, "end_pos": 73774487, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000060288", "url": "https://www.ensembl.org/id/ENSRNOG00000060288" } ] } } ], "crossref": [ { "id": "ENSRNOG00000055247", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000055247", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd21378", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21378", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000717", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000717", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016650", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016650", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019010", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019010", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036390", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "HERFQIG", "url": "https://omabrowser.org/oma/group/HERFQIG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "226348at2759", "url": "http://www.orthodb.org/?query=226348at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10317", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10317", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10317:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10317:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01399", "url": "http://pfam.xfam.org/family/PF01399", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF09440", "url": "http://pfam.xfam.org/family/PF09440", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "2319808", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2319808", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K273", "url": "https://www.uniprot.org/uniprot/A0A0G2K273", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K273-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K273-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDMLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYFNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISSNMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKGLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY", "length": 445, "header": "tr|A0A0G2K273-1|A0A0G2K273_RAT Isoform 1 of Eukaryotic translation initiation factor 3 subunit E OS=Rattus norvegicus OX=10116 GN=LOC100365062 PE=3 SV=1 CANONICAL=A0A0G2K273-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K273-1", "url": "", "sequence": { "sequence": "MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDMLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYFNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISSNMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKGLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY", "length": 445, "header": "tr|A0A0G2K273-1|A0A0G2K273_RAT Isoform 1 of Eukaryotic translation initiation factor 3 subunit E OS=Rattus norvegicus OX=10116 GN=LOC100365062 PE=3 SV=1 CANONICAL=A0A0G2K273-1" }, "locus": { "chromosome": "1", "start_pos": 73775839, "end_pos": 73774505, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000084168.2", "url": "https://www.ensembl.org/id/ENSRNOT00000084168.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000072131.1", "url": "https://www.ensembl.org/id/ENSRNOP00000072131.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K273", "url": "https://www.uniprot.org/uniprot/A0A0G2K273" } ], "pmid": "" }, { "name": "PML body", "id": "GO:0016605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016605", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K273", "url": "https://www.uniprot.org/uniprot/A0A0G2K273" } ], "pmid": "" }, { "name": "eukaryotic 43S preinitiation complex", "id": "GO:0016282", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016282", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K273", "url": "https://www.uniprot.org/uniprot/A0A0G2K273" } ], "pmid": "" }, { "name": "eukaryotic 48S preinitiation complex", "id": "GO:0033290", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033290", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K273", "url": "https://www.uniprot.org/uniprot/A0A0G2K273" } ], "pmid": "" }, { "name": "eukaryotic translation initiation factor 3 complex, eIF3e", "id": "GO:0071540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071540", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K273", "url": "https://www.uniprot.org/uniprot/A0A0G2K273" } ], "pmid": "" }, { "name": "eukaryotic translation initiation factor 3 complex", "id": "GO:0005852", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005852", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K273", "url": "https://www.uniprot.org/uniprot/A0A0G2K273" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "translational initiation", "id": "GO:0006413", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006413", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K273", "url": "https://www.uniprot.org/uniprot/A0A0G2K273" } ], "pmid": "" }, { "name": "formation of cytoplasmic translation initiation complex", "id": "GO:0001732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001732", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K273", "url": "https://www.uniprot.org/uniprot/A0A0G2K273" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "translation initiation factor activity", "id": "GO:0003743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003743", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K273", "url": "https://www.uniprot.org/uniprot/A0A0G2K273" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 143, "end_pos": 145, "annotation": "n_glycosylation_sequon" }, { "start_pos": 198, "end_pos": 200, "annotation": "n_glycosylation_sequon" }, { "start_pos": 361, "end_pos": 363, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }