{ "uniprot_canonical_ac": "A0A0G2K1H0-1", "uniprot_ac": "A0A0G2K1H0", "uniprot_id": "A0A0G2K1H0_RAT", "mass": { "chemical_mass": 175266.0, "monoisotopic_mass": 175266.0 }, "refseq": {}, "gene_names": [ { "name": "Kdm5c", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0", "id": "A0A0G2K1H0" } ], "protein_names": [ { "name": "[histone H3]-trimethyl-L-lysine(4) demethylase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0G2K1H0" }, { "name": "1.14.11.67", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K1H0" } ], "function": [], "disease": [ { "disease_id": "DOID:0050888", "recommended_name": { "id": "DOID:0050888", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050888", "name": "syndromic intellectual disability", "description": "An intellectual disability that is characterized by the presence of associated medical and behavioral sign and symptoms." }, "synonyms": [], "evidence": [ { "id": "0050888", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050888" } ] }, { "disease_id": "DOID:0060041", "recommended_name": { "id": "DOID:0060041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060041", "name": "autism spectrum disorder", "description": "A pervasive developmental disorder that is a spectrum of psychological conditions. The disease has_symptom widespread abnormalities of social interactions and communication, has_symptom severely restricted interests and has_symptom highly repetitive behavior." }, "synonyms": [], "evidence": [ { "id": "0060041", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060041" } ] }, { "disease_id": "DOID:0060809", "recommended_name": { "id": "DOID:0060809", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060809", "name": "syndromic X-linked intellectual disability Claes-Jensen type", "description": "A syndromic X-linked intellectual disability characterized by severe intellectual deficit associated with variable clinical manifestations including spasticity, cryptorchidism, maxillary hypoplasia, alopecia areata, epilepsy, short stature, impaired speech and behavioral problems that has_material_basis_in mutation in the KDM5C gene on chromosome Xp11." }, "synonyms": [ { "id": "DOID:0060809", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060809", "name": "MRXSCJ", "description": "" }, { "id": "DOID:0060809", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060809", "name": "MRXSJ", "description": "" }, { "id": "DOID:0060809", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060809", "name": "syndromic X-linked intellectual disability due to JARID1C mutation", "description": "" }, { "id": "DOID:0060809", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060809", "name": "syndromic X-linked mental retardation JARID1C-related", "description": "" }, { "id": "DOID:0060809", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060809", "name": "mental retardation, X-linked, syndromic, Claes-Jensen type", "description": "" }, { "id": "MONDO:0010355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010355", "name": "syndromic X-linked intellectual disability Claes-Jensen type", "description": "" }, { "id": "MONDO:0010355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010355", "name": "MRXSCJ", "description": "" }, { "id": "MONDO:0010355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010355", "name": "MRXSJ", "description": "" }, { "id": "MONDO:0010355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010355", "name": "intellectual developmental disorder, X-linked syndromic, Claes-Jensen type, X-linked recessive", "description": "" }, { "id": "MONDO:0010355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010355", "name": "intellectual disability, X-linked, syndromic, Claes-Jensen type", "description": "" }, { "id": "MONDO:0010355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010355", "name": "mental retardation, X-linked, syndromic, Claes-Jensen type", "description": "" }, { "id": "MONDO:0010355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010355", "name": "syndromic X-linked intellectual disability Claes-Jensen type", "description": "" }, { "id": "MONDO:0010355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010355", "name": "syndromic X-linked intellectual disability JARID1C-related", "description": "" }, { "id": "MONDO:0010355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010355", "name": "syndromic X-linked intellectual disability due to JARID1C mutation", "description": "" }, { "id": "MONDO:0010355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010355", "name": "syndromic X-linked mental retardation JARID1C-related", "description": "" }, { "id": "MONDO:0010355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010355", "name": "intellectual disability, X-linked, syndromic, JARID1C-related", "description": "" }, { "id": "MONDO:0010355", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010355", "name": "mental retardation, X-linked, syndromic, JARID1C-related", "description": "" }, { "id": "MIM:300534", "resource": "MIM", "url": "https://www.omim.org/entry/300534", "name": "Intellectual developmental disorder, X-linked, syndromic, Claes-Jensen type", "description": "Intellectual developmental disorder, X-linked, syndromic, Claes-Jensen type" } ], "evidence": [ { "id": "0060809", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060809" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ], "evidence": [ { "id": "10534", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] }, { "disease_id": "DOID:1059", "recommended_name": { "id": "DOID:1059", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1059", "name": "intellectual disability", "description": "A specific developmental disorder that involves significant limitations both in mental functioning and in adaptive behavior such as communicating, taking care of him or herself, and social skills." }, "synonyms": [], "evidence": [ { "id": "1059", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1059" } ] }, { "disease_id": "DOID:12190", "recommended_name": { "id": "DOID:12190", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12190", "name": "descending colon cancer", "description": "" }, "synonyms": [ { "id": "DOID:12190", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12190", "name": "Ca descending colon", "description": "" }, { "id": "DOID:12190", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12190", "name": "malignant neoplasm of left colon", "description": "" }, { "id": "DOID:12190", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12190", "name": "malignant tumor of descending colon", "description": "" } ], "evidence": [ { "id": "12190", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12190" } ] }, { "disease_id": "DOID:12858", "recommended_name": { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "Huntington's disease", "description": "A neurodegenerative disease that has_material_basis_in autosomal dominant inheritance and is characterized by unwanted choreatic movements, behavioral and psychiatric disturbances and dementia and has_material_basis_in expansion of CAG triplet repeats (glutamine) resulting in neuron degeneration affecting muscle coordination, cognitive abilities." }, "synonyms": [ { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "HD", "description": "" }, { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "Huntington disease", "description": "" }, { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "Huntington's chorea", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington disease", "description": "Huntington disease (HD) is a rare neurodegenerative disorder of the central nervous system characterized by unwanted choreatic movements, behavioral and psychiatric disturbances and dementia." }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "HD", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington chorea", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington disease", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington's chorea", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington's disease", "description": "" }, { "id": "MIM:143100", "resource": "MIM", "url": "https://www.omim.org/entry/143100", "name": "Huntington disease", "description": "Huntington disease" } ], "evidence": [ { "id": "12858", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12858" } ] }, { "disease_id": "DOID:1574", "recommended_name": { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "alcohol use disorder", "description": "A substance abuse that involves the recurring use of alcoholic beverages despite negative consequences." }, "synonyms": [ { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "Ethanol abuse", "description": "" }, { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "alcohol abuse", "description": "" } ], "evidence": [ { "id": "1574", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1574" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ], "evidence": [ { "id": "1612", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] }, { "disease_id": "DOID:219", "recommended_name": { "id": "DOID:219", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:219", "name": "colon cancer", "description": "A colorectal cancer that is located_in the colon." }, "synonyms": [], "evidence": [ { "id": "219", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:219" } ] }, { "disease_id": "DOID:5419", "recommended_name": { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia", "description": "A psychotic disorder that is characterized by a disintegration of thought processes and of emotional responsiveness." }, "synonyms": [ { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "A major psychotic disorder characterized by abnormalities in the perception or expression of reality. It affects the cognitive and psychomotor functions. Common clinical signs and symptoms include delusions, hallucinations, disorganized thinking, and retreat from reality." }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia 12", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia (disease)", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "SCZD", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizoaffective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia with or without an affective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia, susceptibility to", "description": "" }, { "id": "MIM:181500", "resource": "MIM", "url": "https://www.omim.org/entry/181500", "name": "Schizophrenia", "description": "Schizophrenia" } ], "evidence": [ { "id": "5419", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5419" } ] }, { "disease_id": "DOID:684", "recommended_name": { "id": "DOID:684", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:684", "name": "hepatocellular carcinoma", "description": "A liver carcinoma that has_material_basis_in undifferentiated hepatocytes and located_in the liver." }, "synonyms": [ { "id": "DOID:684", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:684", "name": "Hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation." }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "HCC", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "cancer, hepatocellular", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma, hepatocellular, malignant", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular adenocarcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, childhood type, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell cancer (hepatocellular carcinoma)", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult primary hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma caused by somatic mutation", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver and intrahepatic bile duct carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation." }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "HCC", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "cancer, hepatocellular", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma, hepatocellular, malignant", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular adenocarcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, childhood type, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell cancer (hepatocellular carcinoma)", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult primary hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma caused by somatic mutation", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver and intrahepatic bile duct carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cancer", "description": "" }, { "id": "MIM:114550", "resource": "MIM", "url": "https://www.omim.org/entry/114550", "name": "Hepatocellular carcinoma", "description": "Hepatocellular carcinoma" } ], "evidence": [ { "id": "684", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:684" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ], "evidence": [ { "id": "9256", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K1H0", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ], "common_name": "Rat" } ], "gene": [ { "name": "Kdm5c", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0", "locus": { "chromosome": "X", "start_pos": 21381870, "end_pos": 21345481, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000057706", "url": "https://www.ensembl.org/id/ENSRNOG00000057706" } ] } } ], "crossref": [ { "id": "ENSRNOG00000057706", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000057706", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15604", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15604", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd16875", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16875", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001606", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001606", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001965", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001965", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003347", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003347", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003349", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003349", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004198", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004198", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011011", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011011", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013637", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013637", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019786", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019786", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019787", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019787", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036431", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036431", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "WPRLGSQ", "url": "https://omabrowser.org/oma/group/WPRLGSQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR10694", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10694", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10694:SF43", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10694:SF43", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00628", "url": "http://pfam.xfam.org/family/PF00628", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01388", "url": "http://pfam.xfam.org/family/PF01388", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02373", "url": "http://pfam.xfam.org/family/PF02373", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02375", "url": "http://pfam.xfam.org/family/PF02375", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02928", "url": "http://pfam.xfam.org/family/PF02928", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08429", "url": "http://pfam.xfam.org/family/PF08429", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-3214842", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3214842", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_006227366", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006227366", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1560601", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1560601", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "60208", "url": "https://www.rhea-db.org/rhea/60208", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2JW30", "url": "https://www.uniprot.org/uniprot/A0A0G2JW30", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JW30-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JW30-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K1H0", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K1H0-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K897", "url": "https://www.uniprot.org/uniprot/A0A0G2K897", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K897-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K897-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MELGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVVEEGGYETICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVQCNTRPFDNEEKDKEYKPHSIPLRQSVQPSKFNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYGAGPKMMGLGLMAKDKNLRKKDKEGPECPPTVVVKEELGGDVKMESASPKTFLEGKEELSHSPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCVMAECKRPPEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTELVEKEFWRLVNSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDLNLAAAVHKEMFIMVQEERRLRKALLEKGITEAEREAFELLPDDERQCIKCKTTCFLSALACYDCPDGLVCLSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFDTWANKVRVALEVEDGRKRSLEELRALESEARERRFPNSELLQRLKNCLSEAEACVSRALGLVSGQEAGPDRVAGVQMTLAELQDFLGQMNNLPCAMHQIGDVKGILEQVEAYQTEAREALVSQPSSPGLLQSLLERGQQLGVEVPEAQQLQRQVEQARWLDEVKRTLAPSARRGTLAIMRGLLVAGASVAPSPAVDKAQAELQELLTIAERWEEKAHLCLEARQKHPPATLEAIIHEAENIPVHLPNIQSLKEALAKARAWIADVDEIQNGDHYPCLDDLEGLVAVGRDLPVGLEELRQLELQVLTAHSWREKASKTFLKKNSCYTLLEVLCPCADAGSDSTKRSRWMEKELGLYKSDTELLGLSAQDLRDPGSVIVAFKEGEQKEKEGILQLRRTNSAKPSPLASLTTNSSTASICVCGQVPAGVGALQCDLCQDWFHGRCVTVPRLLSSQRSSLTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLVALQRLPVRLPEGEALQCLTERAISWQGRARQVLASEEVTALLGRLAELRQRLQAESKPEESLAYSSDGGDGTGNMPKVQGLLENGDSVTSPEKVATEEGSGKRDLELLSSLLPQLTGPVLELPEATRAPLEELMMEGDLLEVTLDENHSIWQLLQAGQPPDLKRVQTLLELEKAERHGSRTRGRALERRRRRKVDRGGEPDDPAREELEPKRVRSSGPEAEEVQEEEELEEETGGEVPPVPFPNNGSPSTQEDQDGLEPVLDAGSDTSAPFSTLTSRLLMSCPQQPSLQQL", "length": 1554, "header": "tr|A0A0G2K1H0-1|A0A0G2K1H0_RAT Isoform 1 of [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=1 SV=1 CANONICAL=A0A0G2K1H0-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JW30-1", "url": "", "sequence": { "sequence": "MELGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPAIVVEEGGYETICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVQCNTRPFDNEEKDKEYKPHSIPLRQSVQPSKFNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYGAGPKMMGLGLMAKDKNLRKKDKEGPECPPTVVVKEELGGDVKMESASPKTFLEGKEELSHSPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCVMAECKRPPEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTELVEKEFWRLVNSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDLNLAAAVHKEMFIMVQEERRLRKALLEKVSGGAFDQGS", "length": 630, "header": "tr|A0A0G2JW30-1|A0A0G2JW30_RAT Computationally mapped isoform of [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=3 SV=2 CANONICAL=A0A0G2K1H0-1" }, "locus": { "chromosome": "X", "start_pos": 21371310, "end_pos": 21345804, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000086952.2", "url": "https://www.ensembl.org/id/ENSRNOT00000086952.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000069719.2", "url": "https://www.ensembl.org/id/ENSRNOP00000069719.2" } ] } }, { "isoform_ac": "A0A0G2K1H0-1", "url": "", "sequence": { "sequence": "MELGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVVEEGGYETICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVQCNTRPFDNEEKDKEYKPHSIPLRQSVQPSKFNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYGAGPKMMGLGLMAKDKNLRKKDKEGPECPPTVVVKEELGGDVKMESASPKTFLEGKEELSHSPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCVMAECKRPPEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTELVEKEFWRLVNSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDLNLAAAVHKEMFIMVQEERRLRKALLEKGITEAEREAFELLPDDERQCIKCKTTCFLSALACYDCPDGLVCLSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFDTWANKVRVALEVEDGRKRSLEELRALESEARERRFPNSELLQRLKNCLSEAEACVSRALGLVSGQEAGPDRVAGVQMTLAELQDFLGQMNNLPCAMHQIGDVKGILEQVEAYQTEAREALVSQPSSPGLLQSLLERGQQLGVEVPEAQQLQRQVEQARWLDEVKRTLAPSARRGTLAIMRGLLVAGASVAPSPAVDKAQAELQELLTIAERWEEKAHLCLEARQKHPPATLEAIIHEAENIPVHLPNIQSLKEALAKARAWIADVDEIQNGDHYPCLDDLEGLVAVGRDLPVGLEELRQLELQVLTAHSWREKASKTFLKKNSCYTLLEVLCPCADAGSDSTKRSRWMEKELGLYKSDTELLGLSAQDLRDPGSVIVAFKEGEQKEKEGILQLRRTNSAKPSPLASLTTNSSTASICVCGQVPAGVGALQCDLCQDWFHGRCVTVPRLLSSQRSSLTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLVALQRLPVRLPEGEALQCLTERAISWQGRARQVLASEEVTALLGRLAELRQRLQAESKPEESLAYSSDGGDGTGNMPKVQGLLENGDSVTSPEKVATEEGSGKRDLELLSSLLPQLTGPVLELPEATRAPLEELMMEGDLLEVTLDENHSIWQLLQAGQPPDLKRVQTLLELEKAERHGSRTRGRALERRRRRKVDRGGEPDDPAREELEPKRVRSSGPEAEEVQEEEELEEETGGEVPPVPFPNNGSPSTQEDQDGLEPVLDAGSDTSAPFSTLTSRLLMSCPQQPSLQQL", "length": 1554, "header": "tr|A0A0G2K1H0-1|A0A0G2K1H0_RAT Isoform 1 of [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=1 SV=1 CANONICAL=A0A0G2K1H0-1" }, "locus": { "chromosome": "X", "start_pos": 21381197, "end_pos": 21345804, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000079909.2", "url": "https://www.ensembl.org/id/ENSRNOT00000079909.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000071836.2", "url": "https://www.ensembl.org/id/ENSRNOP00000071836.2" } ] } }, { "isoform_ac": "A0A0G2K897-1", "url": "", "sequence": { "sequence": "MELGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDNFRFTPRIQRLNELEIVVEEGGYETICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVQCNTRPFDNEEKDKEYKPHSIPLRQSVQPSKFNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYGAGPKMMGLGLMAKDKNLRKKDKEGPECPPTVVVKEELGGDVKMESASPKTFLEGKEELSHSPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCVMAECKRPPEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTELVEKEFWRLVNSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDLNLAAAVHKEMFIMVQEERRLRKALLEKGITEAEREAFELLPDDERQCIKCKTTCFLSALACYDCPDGLVCLSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFDTWANKVRVALEVEDGRKRSLEELRALESEARERRFPNSELLQRLKNCLSEAEACVSRALGLVSGQEAGPDRVAGVQMTLAELQDFLGQMNNLPCAMHQIGDVKGILEQVEAYQTEAREALVSQPSSPGLLQSLLERGQQLGVEVPEAQQLQRQVEQARWLDEVKRTLAPSARRGTLAIMRGLLVAGASVAPSPAVDKAQAELQELLTIAERWEEKAHLCLEARQKHPPATLEAIIHEAENIPVHLPNIQSLKEALAKARAWIADVDEIQNGDHYPCLDDLEGLVAVGRDLPVGLEELRQLELQVLTAHSWREKASKTFLKKNSCYTLLEVLCPCADAGSDSTKRSRWMEKELGLYKSDTELLGLSAQDLRDPGSVIVAFKEGEQKEKEGILQLRRTNSAKPSPLASLTTNSSTASICVCGQVPAGVGALQCDLCQDWFHGRCVTVPRLLSSQRSSLTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLVALQRLPVRLPEGEALQCLTERAISWQGRARQVLASEEVTALLGRLAELRQRLQAESKPEESLAYSSDGGDGTGNMPKVQGLLENGDSVTSPEKVATEEGSDLELLSSLLPQLTGPVLELPEATRAPLEELMMEGDLLEVTLDENHSIWQLLQAGQPPDLKRVQTLLELEKAERHGSRTRGRALERRRRRKVDRGGEPDDPAREELEPKRVRSSGPEAEEVQEEEELEEETGGEVPPVPFPNNGSPSTQEDQDGLEPVLDAGSDTSAPFSTLTSRLLMSCPQQPSLQQL", "length": 1510, "header": "tr|A0A0G2K897-1|A0A0G2K1H0_RAT Computationally mapped isoform of [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=1 SV=2 CANONICAL=A0A0G2K1H0-1" }, "locus": { "chromosome": "X", "start_pos": 21381197, "end_pos": 21345804, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000082725.2", "url": "https://www.ensembl.org/id/ENSRNOT00000082725.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000074522.2", "url": "https://www.ensembl.org/id/ENSRNOP00000074522.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "R-RNO-3214842", "name": "HDMs demethylate histones", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3214842", "resource": "Reactome", "description": "HDMs demethylate histones" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "histone H3K4me/H3K4me2/H3K4me3 demethylase activity", "id": "GO:0034647", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034647", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K1H0", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ], "pmid": "" }, { "name": "histone H3K4 demethylase activity", "id": "GO:0032453", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032453", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K1H0", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K1H0", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K1H0", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ], "pmid": "" }, { "name": "dioxygenase activity", "id": "GO:0051213", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051213", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K1H0", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K1H0", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K1H0", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K1H0", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "chromatin remodeling", "id": "GO:0006338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006338", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K1H0", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ], "pmid": "" }, { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K1H0", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K1H0", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ], "pmid": "" }, { "name": "response to toxic substance", "id": "GO:0009636", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009636", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K1H0", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1181, "end_pos": 1183, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1410, "end_pos": 1412, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1508, "end_pos": 1510, "annotation": "n_glycosylation_sequon" }, { "start_pos": 315, "end_pos": 317, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "60208", "name": "", "equation": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A8I5ZPK6-1", "A0A0G2K1H0-1", "A0A0G2K3N6-1", "A0A0G2K6V2-1", "Q9UGL1-1", "Q9BY66-1", "P29375-1", "P41229-1", "Q62240-1", "Q3UXZ9-1", "Q80Y84-1", "P41230-1", "P47156-1", "Q9VMJ7-1" ], "evidence": [ { "id": "60208", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/60208" } ] }, { "id": "R-RNO-4754181", "name": "KDM5A-D demethylate Me2K5-histone H3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K3N6-1", "A0A0G2K1H0-1", "A0A8I5ZPK6-1" ], "evidence": [ { "id": "R-RNO-4754181", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-4754181" } ] }, { "id": "R-RNO-5661116", "name": "KDM5A-D demethylate Me3K5-histone H3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K3N6-1", "A0A0G2K1H0-1", "A0A8I5ZPK6-1" ], "evidence": [ { "id": "R-RNO-5661116", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5661116" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K1H0", "gene_name": "Kdm5c", "activity": [ { "ec_number": "1.14.11.67", "activity": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate.", "evidence": [ { "id": "A0A0G2K1H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ] }, { "ec_number": "1.14.11.67", "activity": "", "evidence": [ { "id": "A0A0G2K1H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K1H0" } ] } ] }, { "uniprot_ac": "A0A0G2K3N6", "gene_name": "Kdm5b", "activity": [ { "ec_number": "1.14.11.67", "activity": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate.", "evidence": [ { "id": "A0A0G2K3N6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K3N6" } ] }, { "ec_number": "1.14.11.67", "activity": "", "evidence": [ { "id": "A0A0G2K3N6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K3N6" } ] } ] }, { "uniprot_ac": "A0A0G2K6V2", "gene_name": "Kdm5d", "activity": [ { "ec_number": "1.14.11.67", "activity": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate.", "evidence": [ { "id": "A0A0G2K6V2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K6V2" } ] }, { "ec_number": "1.14.11.67", "activity": "", "evidence": [ { "id": "A0A0G2K6V2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K6V2" } ] } ] }, { "uniprot_ac": "A0A8I5ZPK6", "gene_name": "Kdm5a", "activity": [ { "ec_number": "1.14.11.67", "activity": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate.", "evidence": [ { "id": "A0A8I5ZPK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPK6" } ] }, { "ec_number": "1.14.11.67", "activity": "", "evidence": [ { "id": "A0A8I5ZPK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZPK6" } ] } ] }, { "uniprot_ac": "P29375", "gene_name": "KDM5A", "activity": [ { "ec_number": "1.14.11.67", "activity": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate.", "evidence": [ { "id": "P29375", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29375" } ] }, { "ec_number": "1.14.11.67", "activity": "", "evidence": [ { "id": "P29375", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29375" } ] } ] }, { "uniprot_ac": "P41229", "gene_name": "KDM5C", "activity": [ { "ec_number": "1.14.11.67", "activity": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate.", "evidence": [ { "id": "P41229", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41229" } ] }, { "ec_number": "1.14.11.67", "activity": "", "evidence": [ { "id": "P41229", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41229" } ] } ] }, { "uniprot_ac": "P41230", "gene_name": "Kdm5c", "activity": [ { "ec_number": "1.14.11.67", "activity": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate.", "evidence": [ { "id": "P41230", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41230" } ] }, { "ec_number": "1.14.11.67", "activity": "", "evidence": [ { "id": "P41230", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41230" } ] } ] }, { "uniprot_ac": "P47156", "gene_name": "JHD2", "activity": [ { "ec_number": "1.14.11.67", "activity": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate.", "evidence": [ { "id": "P47156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47156" } ] }, { "ec_number": "1.14.11.67", "activity": "", "evidence": [ { "id": "P47156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47156" } ] } ] }, { "uniprot_ac": "Q3UXZ9", "gene_name": "Kdm5a", "activity": [ { "ec_number": "1.14.11.67", "activity": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate.", "evidence": [ { "id": "Q3UXZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UXZ9" } ] }, { "ec_number": "1.14.11.67", "activity": "", "evidence": [ { "id": "Q3UXZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UXZ9" } ] } ] }, { "uniprot_ac": "Q62240", "gene_name": "Kdm5d", "activity": [ { "ec_number": "1.14.11.67", "activity": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate.", "evidence": [ { "id": "Q62240", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62240" } ] }, { "ec_number": "1.14.11.67", "activity": "", "evidence": [ { "id": "Q62240", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62240" } ] } ] }, { "uniprot_ac": "Q80Y84", "gene_name": "Kdm5b", "activity": [ { "ec_number": "1.14.11.67", "activity": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate.", "evidence": [ { "id": "Q80Y84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80Y84" } ] }, { "ec_number": "1.14.11.67", "activity": "", "evidence": [ { "id": "Q80Y84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80Y84" } ] } ] }, { "uniprot_ac": "Q9BY66", "gene_name": "KDM5D", "activity": [ { "ec_number": "1.14.11.67", "activity": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate.", "evidence": [ { "id": "Q9BY66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY66" } ] }, { "ec_number": "1.14.11.67", "activity": "", "evidence": [ { "id": "Q9BY66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY66" } ] } ] }, { "uniprot_ac": "Q9UGL1", "gene_name": "KDM5B", "activity": [ { "ec_number": "1.14.11.67", "activity": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate.", "evidence": [ { "id": "Q9UGL1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UGL1" } ] }, { "ec_number": "1.14.11.67", "activity": "", "evidence": [ { "id": "Q9UGL1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UGL1" } ] } ] }, { "uniprot_ac": "Q9VMJ7", "gene_name": "Kdm5", "activity": [ { "ec_number": "1.14.11.67", "activity": "3 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 O2 = 3 CO2 + 3 formaldehyde + L-lysyl(4)-[histone H3] + 3 succinate.", "evidence": [ { "id": "Q9VMJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMJ7" } ] }, { "ec_number": "1.14.11.67", "activity": "", "evidence": [ { "id": "Q9VMJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMJ7" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }