{ "uniprot_canonical_ac": "A0A0G2K171-1", "uniprot_ac": "A0A0G2K171", "uniprot_id": "A0A0G2K171_RAT", "mass": { "chemical_mass": 54769.0, "monoisotopic_mass": 54769.0 }, "refseq": {}, "gene_names": [ { "name": "Slc19a3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K171", "id": "A0A0G2K171" } ], "protein_names": [ { "name": "Solute carrier family 19 member 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K171" } ], "function": [], "disease": [ { "disease_id": "DOID:0050659", "recommended_name": { "id": "DOID:0050659", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050659", "name": "biotin-responsive basal ganglia disease", "description": "A basal ganglia disease that is characterized by recurrent subacute encephalopathy, has_symptom confusion, has_symptom seizure, has_symptom ataxia, has_symptom dystonia, has_symptom supranuclear facial palsy, has_symptom external ophthalmoplegia, and has_symptom dysphagia." }, "synonyms": [ { "id": "MONDO:0011841", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011841", "name": "biotin-responsive basal ganglia disease", "description": "" }, { "id": "MONDO:0011841", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011841", "name": "BBGD", "description": "" }, { "id": "MONDO:0011841", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011841", "name": "BTBGD", "description": "" }, { "id": "MONDO:0011841", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011841", "name": "biotin-thiamine-responsive basal ganglia disease", "description": "" }, { "id": "MONDO:0011841", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011841", "name": "thiamine metabolism dysfunction syndrome 2 (biotin- or thiamine-responsive encephalopathy type 2)", "description": "" }, { "id": "MONDO:0011841", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011841", "name": "thiamine-responsive encephalopathy", "description": "" }, { "id": "MONDO:0011841", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011841", "name": "THMD2", "description": "" }, { "id": "MONDO:0011841", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011841", "name": "basal ganglia disease, biotin-responsive", "description": "" }, { "id": "MONDO:0011841", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011841", "name": "encephalopathy, thiamine-responsive", "description": "" }, { "id": "MONDO:0011841", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011841", "name": "thiamine metabolism dysfunction syndrome 2 (biotin- or thiamine-responsive type)", "description": "" }, { "id": "MIM:607483", "resource": "MIM", "url": "https://www.omim.org/entry/607483", "name": "Thiamine metabolism dysfunction syndrome 2, biotin- or thiamine-responsive type", "description": "Thiamine metabolism dysfunction syndrome 2, biotin- or thiamine-responsive type" } ], "evidence": [ { "id": "0050659", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050659" } ] }, { "disease_id": "DOID:784", "recommended_name": { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic kidney disease", "description": "A kidney failure that is characterized by the gradual loss of kidney function." }, "synonyms": [ { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "CKD", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "CRF", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic kidney failure", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic renal disease", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "chronic renal failure syndrome", "description": "" }, { "id": "DOID:784", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:784", "name": "renal failure - chronic", "description": "" } ], "evidence": [ { "id": "784", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:784" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K171", "url": "https://www.uniprot.org/uniprot/A0A0G2K171" } ], "common_name": "Rat" } ], "gene": [ { "name": "Slc19a3", "url": "https://www.uniprot.org/uniprot/A0A0G2K171", "locus": { "chromosome": "9", "start_pos": 84277024, "end_pos": 84299337, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000057256", "url": "https://www.ensembl.org/id/ENSRNOG00000057256" } ] } } ], "crossref": [ { "id": "ENSRNOG00000057256", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000057256", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR002666", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002666", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036259", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036259", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:316559", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:316559", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "DIWACYA", "url": "https://omabrowser.org/oma/group/DIWACYA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "51626at2759", "url": "http://www.orthodb.org/?query=51626at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10686", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10686", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10686:SF37", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10686:SF37", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01770", "url": "http://pfam.xfam.org/family/PF01770", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-196819", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-196819", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "1311413", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1311413", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K171", "url": "https://www.uniprot.org/uniprot/A0A0G2K171", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K171-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K171-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVAMNCCRTPPRDSWVYPTVILCLFGFFSMFRPSESFLIPFLSGPSKNLTSTEMTNEILPVWTYSYLAMLPPVFVLTDYLRYKPIIMLHVMAFTICYLFLLFGQSVMLMQTAEFFFGIVSATEIAYFAYIYSMVSPEHYQKVSSYCRSITLVSYTAGSVLAQLLVSLMNVPYSTLFYISLACVSVAFFVSLFLPMPKKSMFFHTKPNREACPKPLEPCTVLKEAHNNGAQPELFANAQNLGDREQDNSALRIFVYWFQDLKECYSSKHLVYWSLWWAFATAGYNQILNFVQVLWEQKAPSKDSSIYNGAVEAIATFGGALASFSVGYIKVDWDLLGELGLAVFSAVVAGSLLLMNYTLSIWVCYTGYVLVKSSYSFLITIAVFQIAVNLSLERYALVFGIDTFIALVIQTIMTMIVADQRGLQLPVTTQFLVYGSYFAVIAGVFLIRSIYILYSAKCRKEVQNLATTQSPGEPYLQEPRDVSTKF", "length": 485, "header": "tr|A0A0G2K171-1|A0A0G2K171_RAT Isoform 1 of Solute carrier family 19 member 3 OS=Rattus norvegicus OX=10116 GN=Slc19a3 PE=3 SV=2 CANONICAL=A0A0G2K171-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K171-1", "url": "", "sequence": { "sequence": "MVAMNCCRTPPRDSWVYPTVILCLFGFFSMFRPSESFLIPFLSGPSKNLTSTEMTNEILPVWTYSYLAMLPPVFVLTDYLRYKPIIMLHVMAFTICYLFLLFGQSVMLMQTAEFFFGIVSATEIAYFAYIYSMVSPEHYQKVSSYCRSITLVSYTAGSVLAQLLVSLMNVPYSTLFYISLACVSVAFFVSLFLPMPKKSMFFHTKPNREACPKPLEPCTVLKEAHNNGAQPELFANAQNLGDREQDNSALRIFVYWFQDLKECYSSKHLVYWSLWWAFATAGYNQILNFVQVLWEQKAPSKDSSIYNGAVEAIATFGGALASFSVGYIKVDWDLLGELGLAVFSAVVAGSLLLMNYTLSIWVCYTGYVLVKSSYSFLITIAVFQIAVNLSLERYALVFGIDTFIALVIQTIMTMIVADQRGLQLPVTTQFLVYGSYFAVIAGVFLIRSIYILYSAKCRKEVQNLATTQSPGEPYLQEPRDVSTKF", "length": 485, "header": "tr|A0A0G2K171-1|A0A0G2K171_RAT Isoform 1 of Solute carrier family 19 member 3 OS=Rattus norvegicus OX=10116 GN=Slc19a3 PE=3 SV=2 CANONICAL=A0A0G2K171-1" }, "locus": { "chromosome": "9", "start_pos": 84289306, "end_pos": 84277049, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000083667.2", "url": "https://www.ensembl.org/id/ENSRNOT00000083667.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000071722.2", "url": "https://www.ensembl.org/id/ENSRNOP00000071722.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:316559", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:316559", "resource": "KEGG Pathway" }, { "id": "R-RNO-196819", "name": "Vitamin B1 (thiamin) metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-196819", "resource": "Reactome", "description": "Vitamin B1 (thiamin) metabolism" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K171", "url": "https://www.uniprot.org/uniprot/A0A0G2K171" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "transmembrane transport", "id": "GO:0055085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055085", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K171", "url": "https://www.uniprot.org/uniprot/A0A0G2K171" } ], "pmid": "" }, { "name": "thiamine transport", "id": "GO:0015888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015888", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K171", "url": "https://www.uniprot.org/uniprot/A0A0G2K171" } ], "pmid": "" }, { "name": "thiamine transmembrane transport", "id": "GO:0071934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071934", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K171", "url": "https://www.uniprot.org/uniprot/A0A0G2K171" } ], "pmid": "" }, { "name": "pyridoxine transport", "id": "GO:0031923", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031923", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K171", "url": "https://www.uniprot.org/uniprot/A0A0G2K171" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "thiamine transmembrane transporter activity", "id": "GO:0015234", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015234", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K171", "url": "https://www.uniprot.org/uniprot/A0A0G2K171" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 355, "end_pos": 357, "annotation": "n_glycosylation_sequon" }, { "start_pos": 388, "end_pos": 390, "annotation": "n_glycosylation_sequon" }, { "start_pos": 48, "end_pos": 50, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }