{ "uniprot_canonical_ac": "A0A0G2K0L2-1", "uniprot_ac": "A0A0G2K0L2", "uniprot_id": "A0A0G2K0L2_RAT", "mass": { "chemical_mass": 33488.0, "monoisotopic_mass": 33488.0 }, "refseq": { "ac": "NP_001000235", "name": "olfactory receptor Olr298", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000235" }, "gene_names": [ { "name": "Or12j2b", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K0L2", "id": "A0A0G2K0L2" }, { "name": "Olr298", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000235", "id": "NP_001000235" }, { "name": "Or12j2b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000235", "id": "NP_001000235" } ], "protein_names": [ { "name": "Olfactory receptor 298", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K0L2" }, { "name": "olfactory receptor Olr298", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000235", "id": "NP_001000235" }, { "name": "olfactory receptor gene Olr298; olfactory receptor 298", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000235", "id": "NP_001000235" } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001000235", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000235" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K0L2", "url": "https://www.uniprot.org/uniprot/A0A0G2K0L2" } ], "common_name": "Rat" } ], "gene": [ { "name": "Or12j2b", "url": "https://www.uniprot.org/uniprot/A0A0G2K0L2", "locus": {} } ], "crossref": [ { "id": "cd15232", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15232", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "293597", "url": "https://www.ncbi.nlm.nih.gov/gene/293597", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:293597", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:293597", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "RINTWLM", "url": "https://omabrowser.org/oma/group/RINTWLM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5401587at2759", "url": "http://www.orthodb.org/?query=5401587at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR26453", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR26453:SF293", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453:SF293", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001000235", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000235", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1334051", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1334051", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K0L2", "url": "https://www.uniprot.org/uniprot/A0A0G2K0L2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K0L2-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K0L2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNGTLVTEFLILGFSEMPHLRVPLLSFLCLYMAAISGNLLIMVTVSASPALHTPMYFFLVNLAVVDILCTSTILPKLLDIMVGGRTISYGGCMAQLFFFTWSMGAELLLFSAMAYDRFVAICCPLHYSTWMGPRVCAFLAGLVWSISLTNTSVNTSLVLHLPFCSSNVIEHFFCEIPPLLKLSCAPTQLNEVMAFAADVFLAVGNFSVIILSYGFIVTSILKIRSTEGKQRAFSTCSAHLFVVTMYYSTIIYTYIRPASSYSLNKDKVVSIIYTSVAPTLNPLIYTLRNKDVKVALRKLLSSC", "length": 303, "header": "tr|A0A0G2K0L2-1|A0A0G2K0L2_RAT Isoform 1 of Olfactory receptor 298 OS=Rattus norvegicus OX=10116 GN=Or12j2b PE=4 SV=1 CANONICAL=A0A0G2K0L2-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K0L2-1", "url": "", "sequence": { "sequence": "MNGTLVTEFLILGFSEMPHLRVPLLSFLCLYMAAISGNLLIMVTVSASPALHTPMYFFLVNLAVVDILCTSTILPKLLDIMVGGRTISYGGCMAQLFFFTWSMGAELLLFSAMAYDRFVAICCPLHYSTWMGPRVCAFLAGLVWSISLTNTSVNTSLVLHLPFCSSNVIEHFFCEIPPLLKLSCAPTQLNEVMAFAADVFLAVGNFSVIILSYGFIVTSILKIRSTEGKQRAFSTCSAHLFVVTMYYSTIIYTYIRPASSYSLNKDKVVSIIYTSVAPTLNPLIYTLRNKDVKVALRKLLSSC", "length": 303, "header": "tr|A0A0G2K0L2-1|A0A0G2K0L2_RAT Isoform 1 of Olfactory receptor 298 OS=Rattus norvegicus OX=10116 GN=Or12j2b PE=4 SV=1 CANONICAL=A0A0G2K0L2-1" }, "locus": { "chromosome": "1", "start_pos": 195315949, "end_pos": 195315041, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000091487.2", "url": "https://www.ensembl.org/id/ENSRNOT00000091487.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000071491.1", "url": "https://www.ensembl.org/id/ENSRNOP00000071491.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:293597", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:293597", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q7TRT9-1", "protein_name": "Olfactory receptor family 12 subfamily J member 2", "gene_name": "Or12j2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMNGTLVTEFLILGFSEMPHLRVPLLFSFLCLYMAAISGNLLIMVTISASPALHTPMYFFLVNLAIVDILCTSTILPKLLDSMMTGRTISYGGCMAQLFFFTWSLGAELLLFSAMAYDRFVAICCPLHYSAWMGPRVCAFLAGIVWTISLTNTSVHTGLMLRLPFCSSNVIEHFFCEIPPLLKLSCAPTQLNEAMAFAADVFLAVGNFSVTILSYGFIVASILKIRSAEGKRRAFSTCSAHLIVVTMYYSTVIYTYIRPSSSYSLNKDKVVSIIYTSVAPTLNPLIYTLRNKDVKVALRRLLSCC", "length": 305 }, "evidence": [ { "id": "45224872", "url": "http://www.informatics.jax.org/homology/45224872", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8VGL2-1", "protein_name": "Olfactory receptor family 2 subfamily J member 6", "gene_name": "Or2j6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNGTLVTEFLILGFSDMPHLRILLFLSFLCLYMAAVSGNLLIMVTISASPTLHTPMYFFLVNLAVVDILCTSTILPKLLDTMVGGRTISYGGCMAQLFFFTWSLGVELLLFSAMAYDRFVAICCPLHYSTWMGPRVCAFLAGIVWAISLTNTSINSSLVLRLPFCSSNVVEHFFCEIPPLLKLSCAPTQLNEAMAFAADVFLAVGNFSVIILSYGFIVASILKIRSAEGKQRAFSTCSAHLIVVTMYYSTVIYTYIRPSSSYSLNKDKVVSIIYTSVAPTLNPLIYTLRNKDVKVALRRLFSCC", "length": 304 }, "evidence": [ { "id": "45224871", "url": "http://www.informatics.jax.org/homology/45224871", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K0L2", "url": "https://www.uniprot.org/uniprot/A0A0G2K0L2" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K0L2", "url": "https://www.uniprot.org/uniprot/A0A0G2K0L2" } ], "pmid": "" }, { "name": "odorant binding", "id": "GO:0005549", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005549", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K0L2", "url": "https://www.uniprot.org/uniprot/A0A0G2K0L2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K0L2", "url": "https://www.uniprot.org/uniprot/A0A0G2K0L2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "detection of chemical stimulus involved in sensory perception of smell", "id": "GO:0050911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050911", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K0L2", "url": "https://www.uniprot.org/uniprot/A0A0G2K0L2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 150, "end_pos": 152, "annotation": "n_glycosylation_sequon" }, { "start_pos": 154, "end_pos": 156, "annotation": "n_glycosylation_sequon" }, { "start_pos": 205, "end_pos": 207, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2, "end_pos": 4, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }