{ "uniprot_canonical_ac": "A0A0G2K048-1", "uniprot_ac": "A0A0G2K048", "uniprot_id": "A0A0G2K048_RAT", "mass": { "chemical_mass": 67109.0, "monoisotopic_mass": 67109.0 }, "refseq": {}, "gene_names": [ { "name": "Dtx4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K048", "id": "A0A0G2K048" } ], "protein_names": [ { "name": "E3 ubiquitin-protein ligase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0G2K048" }, { "name": "2.3.2.27", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2K048" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K048", "url": "https://www.uniprot.org/uniprot/A0A0G2K048" } ], "common_name": "Rat" } ], "gene": [ { "name": "Dtx4", "url": "https://www.uniprot.org/uniprot/A0A0G2K048", "locus": { "chromosome": "1", "start_pos": 209460735, "end_pos": 209492818, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000021086", "url": "https://www.ensembl.org/id/ENSRNOG00000021086" } ] } } ], "crossref": [ { "id": "ENSRNOG00000021086", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000021086", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd09633", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09633", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd16671", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16671", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001841", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004170", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004170", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018123", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018123", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018957", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018957", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037197", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037197", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039396", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039396", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039398", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039398", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039399", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039399", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:293774", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:293774", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "AIGFCYV", "url": "https://omabrowser.org/oma/group/AIGFCYV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5487971at2759", "url": "http://www.orthodb.org/?query=5487971at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12622", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12622", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12622:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12622:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00097", "url": "http://pfam.xfam.org/family/PF00097", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02825", "url": "http://pfam.xfam.org/family/PF02825", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18102", "url": "http://pfam.xfam.org/family/PF18102", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-2122948", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2122948", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-3134975", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3134975", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-3270619", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3270619", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "1311767", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1311767", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2K048", "url": "https://www.uniprot.org/uniprot/A0A0G2K048", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K048-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K048-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A316", "url": "https://www.uniprot.org/uniprot/A0A8I6A316", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A316-1", "url": "https://www.uniprot.org/uniprot/A0A8I6A316-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AQV0", "url": "https://www.uniprot.org/uniprot/A0A8I6AQV0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AQV0-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AQV0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6TXG2", "url": "https://www.uniprot.org/uniprot/Q6TXG2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q6TXG2-1", "url": "https://www.uniprot.org/uniprot/Q6TXG2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDLQSMNQFRQDTGTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQHAYEKQHPWIDLTSIGFSYIIDFSTMGQINRQTQRQRRVRRRLDLIYPMVTGTVPKAQSWPVSPGPATPSPAPPCSCPQCVLVMSVKAAVVHGSTGPLHPPAARKNIAPSGVGKLPQPPGPGAKPLDTTGTIRGPGKTAPSQVIRRQVSNTPAGVTVGSPASPQGSNRKTGRVALTTLNRSNLQRLAIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPEEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSKCGHIYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTSQEKD", "length": 619, "header": "tr|A0A0G2K048-1|A0A0G2K048_RAT Isoform 1 of E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Dtx4 PE=3 SV=2 CANONICAL=A0A0G2K048-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K048-1", "url": "", "sequence": { "sequence": "MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDLQSMNQFRQDTGTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQHAYEKQHPWIDLTSIGFSYIIDFSTMGQINRQTQRQRRVRRRLDLIYPMVTGTVPKAQSWPVSPGPATPSPAPPCSCPQCVLVMSVKAAVVHGSTGPLHPPAARKNIAPSGVGKLPQPPGPGAKPLDTTGTIRGPGKTAPSQVIRRQVSNTPAGVTVGSPASPQGSNRKTGRVALTTLNRSNLQRLAIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPEEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSKCGHIYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTSQEKD", "length": 619, "header": "tr|A0A0G2K048-1|A0A0G2K048_RAT Isoform 1 of E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Dtx4 PE=3 SV=2 CANONICAL=A0A0G2K048-1" }, "locus": { "chromosome": "1", "start_pos": 209491856, "end_pos": 209460823, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000083283.2", "url": "https://www.ensembl.org/id/ENSRNOT00000083283.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000071301.2", "url": "https://www.ensembl.org/id/ENSRNOP00000071301.2" } ] } }, { "isoform_ac": "A0A8I6A316-1", "url": "", "sequence": { "sequence": "LYGLVFLLLVTSPVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPEEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSKCGHIYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTSQEKD", "length": 320, "header": "tr|A0A8I6A316-1|A0A8I6A316_RAT Computationally mapped isoform of E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Dtx4 PE=3 SV=1 CANONICAL=A0A0G2K048-1" }, "locus": { "chromosome": "1", "start_pos": 209478098, "end_pos": 209460823, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000103725.1", "url": "https://www.ensembl.org/id/ENSRNOT00000103725.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000087356.1", "url": "https://www.ensembl.org/id/ENSRNOP00000087356.1" } ] } }, { "isoform_ac": "A0A8I6AQV0-1", "url": "", "sequence": { "sequence": "MEIKTWIHRNWVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPEEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSKCGHIYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTSQEKD", "length": 318, "header": "tr|A0A8I6AQV0-1|A0A8I6AQV0_RAT Computationally mapped isoform of E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Dtx4 PE=3 SV=1 CANONICAL=A0A0G2K048-1" }, "locus": { "chromosome": "1", "start_pos": 209480142, "end_pos": 209460823, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000101313.1", "url": "https://www.ensembl.org/id/ENSRNOT00000101313.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000097092.1", "url": "https://www.ensembl.org/id/ENSRNOP00000097092.1" } ] } }, { "isoform_ac": "Q6TXG2-1", "url": "", "sequence": { "sequence": "MMMMVMMMMVVVVWVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPEEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSKCGHIYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTSQEKD", "length": 321, "header": "tr|Q6TXG2-1|Q6TXG2_RAT Computationally mapped isoform of E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Dtx4 PE=2 SV=1 CANONICAL=A0A0G2K048-1" }, "locus": { "chromosome": "1", "start_pos": 209481073, "end_pos": 209460823, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000028626.7", "url": "https://www.ensembl.org/id/ENSRNOT00000028626.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000028626.5", "url": "https://www.ensembl.org/id/ENSRNOP00000028626.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "rno:293774", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:293774", "resource": "KEGG Pathway" }, { "id": "R-RNO-2122948", "name": "Activated NOTCH1 Transmits Signal to the Nucleus", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2122948", "resource": "Reactome", "description": "Activated NOTCH1 Transmits Signal to the Nucleus" }, { "id": "R-RNO-3134975", "name": "Regulation of innate immune responses to cytosolic DNA", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3134975", "resource": "Reactome", "description": "Regulation of innate immune responses to cytosolic DNA" }, { "id": "R-RNO-3270619", "name": "IRF3-mediated induction of type I IFN", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3270619", "resource": "Reactome", "description": "IRF3-mediated induction of type I IFN" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K048", "url": "https://www.uniprot.org/uniprot/A0A0G2K048" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K048", "url": "https://www.uniprot.org/uniprot/A0A0G2K048" } ], "pmid": "" }, { "name": "centrosome", "id": "GO:0005813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K048", "url": "https://www.uniprot.org/uniprot/A0A0G2K048" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "Notch signaling pathway", "id": "GO:0007219", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007219", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K048", "url": "https://www.uniprot.org/uniprot/A0A0G2K048" } ], "pmid": "" }, { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K048", "url": "https://www.uniprot.org/uniprot/A0A0G2K048" } ], "pmid": "" }, { "name": "proteasomal protein catabolic process", "id": "GO:0010498", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010498", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K048", "url": "https://www.uniprot.org/uniprot/A0A0G2K048" } ], "pmid": "" }, { "name": "negative regulation of innate immune response", "id": "GO:0045824", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045824", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K048", "url": "https://www.uniprot.org/uniprot/A0A0G2K048" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K048", "url": "https://www.uniprot.org/uniprot/A0A0G2K048" } ], "pmid": "" }, { "name": "ubiquitin protein ligase activity", "id": "GO:0061630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K048", "url": "https://www.uniprot.org/uniprot/A0A0G2K048" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K048", "url": "https://www.uniprot.org/uniprot/A0A0G2K048" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 293, "end_pos": 295, "annotation": "n_glycosylation_sequon" }, { "start_pos": 322, "end_pos": 324, "annotation": "n_glycosylation_sequon" }, { "start_pos": 374, "end_pos": 376, "annotation": "n_glycosylation_sequon" }, { "start_pos": 585, "end_pos": 587, "annotation": "n_glycosylation_sequon" }, { "start_pos": 99, "end_pos": 101, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-RNO-1912357", "name": "ITCH ubiquitinates DTX", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K048-1", "A0A0G2K9T1-1", "A0A8I6A4D7-1", "G3V658-1" ], "evidence": [ { "id": "R-RNO-1912357", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1912357" } ] }, { "id": "R-RNO-1980125", "name": "ITCH binds DTX", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K048-1", "A0A0G2K9T1-1", "A0A8I6A4D7-1", "G3V658-1" ], "evidence": [ { "id": "R-RNO-1980125", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1980125" } ] }, { "id": "R-RNO-2396007", "name": "IRF3 is phosphorylated by TBK1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytoplasmic vesicle membrane, cytosol", "input_participant_list": [], "output_participant_list": [ "R-RNO-166258" ], "enzyme_list": [ "A0A0G2K048-1" ], "evidence": [ { "id": "R-RNO-2396007", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-2396007" } ] }, { "id": "R-RNO-3249392", "name": "NLRP4 and DTX4 associate with p-S172-TBK1 within STING:TBK1:IRF3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytoplasmic vesicle membrane, cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K048-1" ], "evidence": [ { "id": "R-RNO-3249392", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3249392" } ] }, { "id": "R-RNO-8948709", "name": "DTX4 ubiquitinates p-S172-TBK1 within NLRP4:DTX4:STING:TBK1:IRF3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K048-1" ], "evidence": [ { "id": "R-RNO-8948709", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8948709" } ] } ], "reaction_participants": [ { "participant_id": "R-RNO-166258", "participant_name": "phospho-Irf3 [cytosol]", "crossref": [ { "id": "Q5XIB0", "database": "UniProt", "url": "" }, { "id": "NP_001006970.1", "database": "RefSeq", "url": "" }, { "id": "1549774", "database": "RGD", "url": "" }, { "id": "XP_006229086.1", "database": "RefSeq", "url": "" }, { "id": "XP_006229085.1", "database": "RefSeq", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K048", "gene_name": "Dtx4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A0G2K048", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K048" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "A0A0G2K048", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K048" } ] } ] }, { "uniprot_ac": "A0A0G2K9T1", "gene_name": "Itch", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A0G2K9T1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K9T1" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "A0A0G2K9T1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K9T1" } ] } ] }, { "uniprot_ac": "A0A8I6A4D7", "gene_name": "Dtx1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A0A8I6A4D7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A4D7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "A0A8I6A4D7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A4D7" } ] } ] }, { "uniprot_ac": "G3V658", "gene_name": "Dtx2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "G3V658", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V658" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "G3V658", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V658" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }