{ "uniprot_canonical_ac": "A0A0G2JZM9-1", "uniprot_ac": "A0A0G2JZM9", "uniprot_id": "A0A0G2JZM9_RAT", "mass": { "chemical_mass": 22573.0, "monoisotopic_mass": 22573.0 }, "refseq": { "ac": "NP_001128228", "name": "glucosamine 6-phosphate N-acetyltransferase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001128228" }, "gene_names": [ { "name": "Gnpnat1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9", "id": "A0A0G2JZM9" }, { "name": "Gnpnat1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001128228", "id": "NP_001128228" }, { "name": "RGD1563144", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001128228", "id": "NP_001128228" } ], "protein_names": [ { "name": "Glucosamine 6-phosphate N-acetyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0G2JZM9" }, { "name": "2.3.1.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2JZM9" }, { "name": "glucosamine 6-phosphate N-acetyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001128228", "id": "NP_001128228" } ], "function": [], "disease": [ { "disease_id": "DOID:0080753", "recommended_name": { "id": "DOID:0080753", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080753", "name": "keratosis follicularis spinulosa decalvans", "description": "A keratosis pilaris atrophicans that is characterized by scarring alopecia of the scalp, eyebrows, and axillae, sometimes associated with photophobia and keratoderma." }, "synonyms": [], "evidence": [ { "id": "0080753", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080753" } ] }, { "disease_id": "DOID:162", "recommended_name": { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "cancer", "description": "A disease of cellular proliferation that is malignant and primary, characterized by uncontrolled cellular proliferation, local cell invasion and metastasis." }, "synonyms": [ { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant neoplasm", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "malignant tumor", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:162", "name": "primary cancer", "description": "" } ], "evidence": [ { "id": "162", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:162" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ], "common_name": "Rat" } ], "gene": [ { "name": "Gnpnat1", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9", "locus": { "chromosome": "15", "start_pos": 18596442, "end_pos": 18608739, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000008641", "url": "https://www.ensembl.org/id/ENSRNOG00000008641" } ] } } ], "crossref": [ { "id": "ENSRNOG00000008641", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000008641", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "498486", "url": "https://www.ncbi.nlm.nih.gov/gene/498486", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000182", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000182", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016181", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016181", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039143", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039143", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:498486", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:498486", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NQRYDWI", "url": "https://omabrowser.org/oma/group/NQRYDWI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1341425at2759", "url": "http://www.orthodb.org/?query=1341425at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13355", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13355", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13355:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13355:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00583", "url": "http://pfam.xfam.org/family/PF00583", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "1563144", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1563144", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "10292", "url": "https://www.rhea-db.org/rhea/10292", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JZM9-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AKF3", "url": "https://www.uniprot.org/uniprot/A0A8I6AKF3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AKF3-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AKF3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6KDZ8", "url": "https://www.uniprot.org/uniprot/A6KDZ8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6KDZ8-1", "url": "https://www.uniprot.org/uniprot/A6KDZ8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKPDETPMFDPSLLKEVDWSQNTAIFSPAISPMHPGEGLVLRPLCTADLNKGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKSSFLLLQPVSSLTTRLKNAVVCQCSATRGCLWLLGVQMIRKGGDFLTKGIYFQLESFLALYFSTVCLPFLVVKSMGSKQLCHLLSAAHF", "length": 204, "header": "tr|A0A0G2JZM9-1|A0A0G2JZM9_RAT Isoform 1 of Glucosamine 6-phosphate N-acetyltransferase OS=Rattus norvegicus OX=10116 GN=Gnpnat1 PE=1 SV=1 CANONICAL=A0A0G2JZM9-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JZM9-1", "url": "", "sequence": { "sequence": "MKPDETPMFDPSLLKEVDWSQNTAIFSPAISPMHPGEGLVLRPLCTADLNKGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKSSFLLLQPVSSLTTRLKNAVVCQCSATRGCLWLLGVQMIRKGGDFLTKGIYFQLESFLALYFSTVCLPFLVVKSMGSKQLCHLLSAAHF", "length": 204, "header": "tr|A0A0G2JZM9-1|A0A0G2JZM9_RAT Isoform 1 of Glucosamine 6-phosphate N-acetyltransferase OS=Rattus norvegicus OX=10116 GN=Gnpnat1 PE=1 SV=1 CANONICAL=A0A0G2JZM9-1" }, "locus": { "chromosome": "15", "start_pos": 18604658, "end_pos": 18597145, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000078850.2", "url": "https://www.ensembl.org/id/ENSRNOT00000078850.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000071110.2", "url": "https://www.ensembl.org/id/ENSRNOP00000071110.2" } ] } }, { "isoform_ac": "A0A8I6AKF3-1", "url": "", "sequence": { "sequence": "MKPDETPMFDPSLLKEVDWSQNTAIFSPAISPMHPGEGLVLRPLCTADLNKGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDELCTCNHGNWKLNCYKITLECLPQNVGFYKKFDYTVSEENYMCRRFLK", "length": 174, "header": "tr|A0A8I6AKF3-1|A0A0G2JZM9_RAT Computationally mapped isoform of Glucosamine 6-phosphate N-acetyltransferase OS=Rattus norvegicus OX=10116 GN=Gnpnat1 PE=1 SV=1 CANONICAL=A0A0G2JZM9-1" }, "locus": { "chromosome": "15", "start_pos": 18604658, "end_pos": 18597454, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000115628.1", "url": "https://www.ensembl.org/id/ENSRNOT00000115628.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000093866.1", "url": "https://www.ensembl.org/id/ENSRNOP00000093866.1" } ] } }, { "isoform_ac": "A6KDZ8-1", "url": "", "sequence": { "sequence": "MKPDETPMFDPSLLKEVDWSQNTAIFSPAISPMHPGEGLVLRPLCTADLNKGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFDYTVSEENYMCRRFLK", "length": 184, "header": "tr|A6KDZ8-1|A0A0G2JZM9_RAT Computationally mapped isoform of Glucosamine 6-phosphate N-acetyltransferase OS=Rattus norvegicus OX=10116 GN=Gnpnat1 PE=1 SV=1 CANONICAL=A0A0G2JZM9-1" }, "locus": { "chromosome": "15", "start_pos": 18604658, "end_pos": 18597454, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000012036.7", "url": "https://www.ensembl.org/id/ENSRNOT00000012036.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000012036.3", "url": "https://www.ensembl.org/id/ENSRNOP00000012036.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "rno:498486", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:498486", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q96EK6-1", "protein_name": "Glucosamine 6-phosphate N-acetyltransferase", "gene_name": "GNPNAT1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK", "length": 184 }, "evidence": [ { "id": "45233798", "url": "http://www.informatics.jax.org/homology/45233798", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9JK38-1", "protein_name": "Glucosamine 6-phosphate N-acetyltransferase", "gene_name": "Gnpnat1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKPDETPMFDPSLLKEVDWSQNTAIFSPAISPTHPGEGLVLRPLCTADLNKGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFDYTVSEENYMCRRFLK", "length": 184 }, "evidence": [ { "id": "45233798", "url": "http://www.informatics.jax.org/homology/45233798", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "N-acetylglucosamine metabolic process", "id": "GO:0006044", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006044", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ], "pmid": "" }, { "name": "liver development", "id": "GO:0001889", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001889", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ], "pmid": "" }, { "name": "cellular response to leukemia inhibitory factor", "id": "GO:1990830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990830", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ], "pmid": "" }, { "name": "glucosamine metabolic process", "id": "GO:0006041", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006041", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ], "pmid": "" }, { "name": "UDP-N-acetylglucosamine biosynthetic process", "id": "GO:0006048", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006048", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ], "pmid": "" }, { "name": "late endosome", "id": "GO:0005770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005770", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ], "pmid": "" }, { "name": "endoplasmic reticulum-Golgi intermediate compartment", "id": "GO:0005793", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005793", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ], "pmid": "" }, { "name": "glucosamine 6-phosphate N-acetyltransferase activity", "id": "GO:0004343", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004343", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ], "pmid": "" }, { "name": "monosaccharide binding", "id": "GO:0048029", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048029", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZM9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "10292", "name": "", "equation": "acetyl-CoA + D-glucosamine 6-phosphate = CoA + H(+) + N-acetyl-D-glucosamine 6-phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A8I5Y6Y7-1", "A0A0G2JZM9-1", "Q96EK6-1", "Q9JK38-1", "P43577-1", "Q54WR8-1", "Q9VAI0-1" ], "evidence": [ { "id": "10292", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/10292" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JZM9", "gene_name": "Gnpnat1", "activity": [ { "ec_number": "2.3.1.4", "activity": "acetyl-CoA + D-glucosamine 6-phosphate = CoA + H(+) + N-acetyl-D-glucosamine 6-phosphate.", "evidence": [ { "id": "A0A0G2JZM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ] }, { "ec_number": "2.3.1.4", "activity": "", "evidence": [ { "id": "A0A0G2JZM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZM9" } ] } ] }, { "uniprot_ac": "A0A8I5Y6Y7", "gene_name": "AABR07059877.1", "activity": [ { "ec_number": "2.3.1.4", "activity": "acetyl-CoA + D-glucosamine 6-phosphate = CoA + H(+) + N-acetyl-D-glucosamine 6-phosphate.", "evidence": [ { "id": "A0A8I5Y6Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5Y6Y7" } ] }, { "ec_number": "2.3.1.4", "activity": "", "evidence": [ { "id": "A0A8I5Y6Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5Y6Y7" } ] } ] }, { "uniprot_ac": "P43577", "gene_name": "GNA1", "activity": [ { "ec_number": "2.3.1.4", "activity": "acetyl-CoA + D-glucosamine 6-phosphate = CoA + H(+) + N-acetyl-D-glucosamine 6-phosphate.", "evidence": [ { "id": "P43577", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43577" } ] }, { "ec_number": "2.3.1.4", "activity": "", "evidence": [ { "id": "P43577", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43577" } ] } ] }, { "uniprot_ac": "Q54WR8", "gene_name": "gna1", "activity": [ { "ec_number": "2.3.1.4", "activity": "acetyl-CoA + D-glucosamine 6-phosphate = CoA + H(+) + N-acetyl-D-glucosamine 6-phosphate.", "evidence": [ { "id": "Q54WR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WR8" } ] }, { "ec_number": "2.3.1.4", "activity": "", "evidence": [ { "id": "Q54WR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54WR8" } ] } ] }, { "uniprot_ac": "Q96EK6", "gene_name": "GNPNAT1", "activity": [ { "ec_number": "2.3.1.4", "activity": "acetyl-CoA + D-glucosamine 6-phosphate = CoA + H(+) + N-acetyl-D-glucosamine 6-phosphate.", "evidence": [ { "id": "Q96EK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EK6" } ] }, { "ec_number": "2.3.1.4", "activity": "", "evidence": [ { "id": "Q96EK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EK6" } ] } ] }, { "uniprot_ac": "Q9JK38", "gene_name": "Gnpnat1", "activity": [ { "ec_number": "2.3.1.4", "activity": "acetyl-CoA + D-glucosamine 6-phosphate = CoA + H(+) + N-acetyl-D-glucosamine 6-phosphate.", "evidence": [ { "id": "Q9JK38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JK38" } ] }, { "ec_number": "2.3.1.4", "activity": "", "evidence": [ { "id": "Q9JK38", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JK38" } ] } ] }, { "uniprot_ac": "Q9VAI0", "gene_name": "Gnpnat", "activity": [ { "ec_number": "2.3.1.4", "activity": "acetyl-CoA + D-glucosamine 6-phosphate = CoA + H(+) + N-acetyl-D-glucosamine 6-phosphate.", "evidence": [ { "id": "Q9VAI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VAI0" } ] }, { "ec_number": "2.3.1.4", "activity": "", "evidence": [ { "id": "Q9VAI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VAI0" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }