{ "uniprot_canonical_ac": "A0A0G2JZ79-1", "uniprot_ac": "A0A0G2JZ79", "uniprot_id": "SIR1_RAT", "mass": { "chemical_mass": 62059.0, "monoisotopic_mass": 62059.0 }, "refseq": {}, "gene_names": [ { "name": "Sirt1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79", "id": "A0A0G2JZ79" } ], "protein_names": [ { "name": "NAD-dependent protein deacetylase sirtuin-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0G2JZ79" }, { "name": "2.3.1.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2JZ79" }, { "name": "2.3.1.286", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2JZ79" }, { "name": "NAD-dependent protein deacylase sirtuin-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2JZ79" } ], "function": [ { "annotation": "NAD-dependent protein deacetylase that links transcriptional regulation directly to intracellular energetics and participates in the coordination of several separated cellular functions such as cell cycle, response to DNA damage, metabolism, apoptosis and autophagy. Can modulate chromatin function through deacetylation of histones and can promote alterations in the methylation of histones and DNA, leading to transcriptional repression. Deacetylates a broad range of transcription factors and coregulators, thereby regulating target gene expression positively and negatively. Serves as a sensor of the cytosolic ratio of NAD(+)/NADH which is altered by glucose deprivation and metabolic changes associated with caloric restriction. Is essential in skeletal muscle cell differentiation and in response to low nutrients mediates the inhibitory effect on skeletal myoblast differentiation which also involves 5'-AMP-activated protein kinase (AMPK) and nicotinamide phosphoribosyltransferase (NAMPT). Component of the eNoSC (energy-dependent nucleolar silencing) complex, a complex that mediates silencing of rDNA in response to intracellular energy status and acts by recruiting histone-modifying enzymes. The eNoSC complex is able to sense the energy status of cell: upon glucose starvation, elevation of NAD(+)/NADP(+) ratio activates SIRT1, leading to histone H3 deacetylation followed by dimethylation of H3 at 'Lys-9' (H3K9me2) by SUV39H1 and the formation of silent chromatin in the rDNA locus. Deacetylates 'Lys-266' of SUV39H1, leading to its activation. Inhibits skeletal muscle differentiation by deacetylating PCAF and MYOD1. Deacetylates H2A and 'Lys-26' of H1-4. Deacetylates 'Lys-16' of histone H4 (in vitro). Involved in NR0B2/SHP corepression function through chromatin remodeling: Recruited to LRH1 target gene promoters by NR0B2/SHP thereby stimulating histone H3 and H4 deacetylation leading to transcriptional repression. Proposed to contribute to genomic integrity via positive regulation of telomere length; however, reports on localization to pericentromeric heterochromatin are conflicting. Proposed to play a role in constitutive heterochromatin (CH) formation and/or maintenance through regulation of the available pool of nuclear SUV39H1. Upon oxidative/metabolic stress decreases SUV39H1 degradation by inhibiting SUV39H1 polyubiquitination by MDM2. This increase in SUV39H1 levels enhances SUV39H1 turnover in CH, which in turn seems to accelerate renewal of the heterochromatin which correlates with greater genomic integrity during stress response. Deacetylates 'Lys-382' of p53/TP53 and impairs its ability to induce transcription-dependent proapoptotic program and modulate cell senescence. Deacetylates TAF1B and thereby represses rDNA transcription by the RNA polymerase I. Deacetylates MYC, promotes the association of MYC with MAX and decreases MYC stability leading to compromised transformational capability. Deacetylates FOXO3 in response to oxidative stress thereby increasing its ability to induce cell cycle arrest and resistance to oxidative stress but inhibiting FOXO3-mediated induction of apoptosis transcriptional activity; also leading to FOXO3 ubiquitination and protesomal degradation. Appears to have a similar effect on MLLT7/FOXO4 in regulation of transcriptional activity and apoptosis. Deacetylates DNMT1; thereby impairs DNMT1 methyltransferase-independent transcription repressor activity, modulates DNMT1 cell cycle regulatory function and DNMT1-mediated gene silencing. Deacetylates RELA/NF-kappa-B p65 thereby inhibiting its transactivating potential and augments apoptosis in response to TNF-alpha. Deacetylates HIF1A, KAT5/TIP60, RB1 and HIC1. Deacetylates FOXO1 resulting in its nuclear retention and enhancement of its transcriptional activity leading to increased gluconeogenesis in liver. Inhibits E2F1 transcriptional activity and apoptotic function, possibly by deacetylation. Involved in HES1- and HEY2-mediated transcriptional repression. In cooperation with MYCN seems to be involved in transcriptional repression of DUSP6/MAPK3 leading to MYCN stabilization by phosphorylation at 'Ser-62'. Deacetylates MEF2D. Required for antagonist-mediated transcription suppression of AR-dependent genes which may be linked to local deacetylation of histone H3. Represses HNF1A-mediated transcription. Required for the repression of ESRRG by CREBZF. Deacetylates NR1H3 AND NR1H2 and deacetylation of NR1H3 at 'Lys-434' positively regulates transcription of NR1H3:RXR target genes, promotes NR1H3 proteasomal degradation and results in cholesterol efflux; a promoter clearing mechanism after reach round of transcription is proposed. Involved in lipid metabolism: deacetylates LPIN1, thereby inhibiting diacylglycerol synthesis. Implicated in regulation of adipogenesis and fat mobilization in white adipocytes by repression of PPARG which probably involves association with NCOR1 and SMRT/NCOR2. Deacetylates p300/EP300 and PRMT1. Deacetylates ACSS2 leading to its activation, and HMGCS1 deacetylation. Involved in liver and muscle metabolism. Through deacetylation and activation of PPARGC1A is required to activate fatty acid oxidation in skeletal muscle under low-glucose conditions and is involved in glucose homeostasis. Involved in regulation of PPARA and fatty acid beta-oxidation in liver. Involved in positive regulation of insulin secretion in pancreatic beta cells in response to glucose; the function seems to imply transcriptional repression of UCP2. Proposed to deacetylate IRS2 thereby facilitating its insulin-induced tyrosine phosphorylation. Deacetylates SREBF1 isoform SREBP-1C thereby decreasing its stability and transactivation in lipogenic gene expression. Involved in DNA damage response by repressing genes which are involved in DNA repair, such as XPC and TP73, deacetylating XRCC6/Ku70, and facilitating recruitment of additional factors to sites of damaged DNA, such as SIRT1-deacetylated NBN can recruit ATM to initiate DNA repair and SIRT1-deacetylated XPA interacts with RPA2. Also involved in DNA repair of DNA double-strand breaks by homologous recombination and specifically single-strand annealing independently of XRCC6/Ku70 and NBN. Promotes DNA double-strand breaks by mediating deacetylation of SIRT6. Transcriptional suppression of XPC probably involves an E2F4:RBL2 suppressor complex and protein kinase B (AKT) signaling. Transcriptional suppression of TP73 probably involves E2F4 and PCAF. Deacetylates WRN thereby regulating its helicase and exonuclease activities and regulates WRN nuclear translocation in response to DNA damage. Deacetylates APEX1 at 'Lys-6' and 'Lys-7' and stimulates cellular AP endonuclease activity by promoting the association of APEX1 to XRCC1. Catalyzes deacetylation of ERCC4/XPF, thereby impairing interaction with ERCC1 and nucleotide excision repair (NER). Increases p53/TP53-mediated transcription-independent apoptosis by blocking nuclear translocation of cytoplasmic p53/TP53 and probably redirecting it to mitochondria. Deacetylates XRCC6/Ku70 at 'Lys-539' and 'Lys-542' causing it to sequester BAX away from mitochondria thereby inhibiting stress-induced apoptosis. Is involved in autophagy, presumably by deacetylating ATG5, ATG7 and MAP1LC3B/ATG8. Deacetylates AKT1 which leads to enhanced binding of AKT1 and PDK1 to PIP3 and promotes their activation. Proposed to play role in regulation of STK11/LBK1-dependent AMPK signaling pathways implicated in cellular senescence which seems to involve the regulation of the acetylation status of STK11/LBK1. Can deacetylate STK11/LBK1 and thereby increase its activity, cytoplasmic localization and association with STRAD; however, the relevance of such activity in normal cells is unclear. In endothelial cells is shown to inhibit STK11/LBK1 activity and to promote its degradation. Deacetylates SMAD7 at 'Lys-64' and 'Lys-70' thereby promoting its degradation. Deacetylates CIITA and augments its MHC class II transactivation and contributes to its stability. Deacetylates MECOM/EVI1. Deacetylates PML at 'Lys-487' and this deacetylation promotes PML control of PER2 nuclear localization. During the neurogenic transition, represses selective NOTCH1-target genes through histone deacetylation in a BCL6-dependent manner and leading to neuronal differentiation. Regulates the circadian expression of several core clock genes, including BMAL1, RORC, PER2 and CRY1 and plays a critical role in maintaining a controlled rhythmicity in histone acetylation, thereby contributing to circadian chromatin remodeling. Deacetylates BMAL1 and histones at the circadian gene promoters in order to facilitate repression by inhibitory components of the circadian oscillator. Deacetylates PER2, facilitating its ubiquitination and degradation by the proteasome. Protects cardiomyocytes against palmitate-induced apoptosis. Deacetylates XBP1 isoform 2; deacetylation decreases protein stability of XBP1 isoform 2 and inhibits its transcriptional activity. Deacetylates PCK1 and directs its activity toward phosphoenolpyruvate production promoting gluconeogenesis. Involved in the CCAR2-mediated regulation of PCK1 and NR1D1. Deacetylates CTNB1 at 'Lys-49'. In POMC (pro-opiomelanocortin) neurons, required for leptin-induced activation of PI3K signaling. In addition to protein deacetylase activity, also acts as protein-lysine deacylase by mediating protein depropionylation and decrotonylation. Mediates depropionylation of Osterix (SP7). Catalyzes decrotonylation of histones; it however does not represent a major histone decrotonylase. Deacetylates SOX9; promoting SOX9 nuclear localization and transactivation activity. Involved in the regulation of centrosome duplication. Deacetylates CENATAC in G1 phase, allowing for SASS6 accumulation on the centrosome and subsequent procentriole assembly (By similarity). Deacetylates NDC80/HEC1 (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79#function" }, { "database": "UniProtKB", "id": "Q96EB6", "url": "https://www.uniprot.org/uniprot/Q96EB6#function" }, { "database": "UniProtKB", "id": "Q923E4", "url": "https://www.uniprot.org/uniprot/Q923E4#function" } ] } ], "disease": [ { "disease_id": "DOID:0080208", "recommended_name": { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-associated steatotic liver disease", "description": "A steatotic liver disease characterized by at least one of five cardiometabolic risk factors (adjusted for age, sex and ethnicity), alcohol consumption below 140g/week (female) or 210g/week (male), and no other discernible cause. The five cardiometabolic risk factors are:(1) Body mass index 25 kg/m2 (adult), 23 kg/m2 (adult Asian), or 85th percentile (pediatric); waist circumference > 94 cm (adult male), 80 cm (adult female), or 95th percentile (pediatric); or ethnicity adjusted equivalents.(2) Fasting serum glucose 5.6 mmol/L, 2-hr post-load glucose levels 7.8 mmol/L, glycated hemoglobin (HbA1c) 5.7% (39 mmol/L), type 2 diabetes, treatment for type 2 diabetes, previously diagnosed or treated type 2 diabetes (pediatric only), or serum glucose 11.1 mmol/L (pediatric only).(3) Blood pressure lower of 130/85 mmHg or 95th percentile (age < 13 years), or 130/85 mmHg (age 13 years); or specific hypertensive drug treatment.(4) Plasma triglycerides 1.15 mmol/L (age < 10 years) or 1.70 mmol/L (age 10 years); or lipid lowering treatment.(5) Plasma high-density lipoprotein cholesterol 1.0 mmol/L (adult male, pediatric) or 1.3 mmol/L (adult female); or lipid lowering treatment." }, "synonyms": [ { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "non-alcoholic fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "NAFLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-associated fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-related steatotic liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "MAFLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "MASLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "metabolic-associated fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080208", "name": "nonalcoholic fatty liver disease", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "fatty liver disease, nonalcoholic, susceptibility to, 2", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "NAFLD2", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "fatty liver disease, nonalcoholic, susceptibility to, 2", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "NAFLD1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "NAFLD1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "fatty liver disease, nonalcoholic, susceptibility to, 1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "liver disease, alcoholic, susceptibility to, 1", "description": "" }, { "id": "MIM:613282", "resource": "MIM", "url": "https://www.omim.org/entry/613282", "name": "Non-alcoholic fatty liver disease 1", "description": "Non-alcoholic fatty liver disease 1" } ], "evidence": [ { "id": "0080208", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080208" } ] }, { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ], "evidence": [ { "id": "10283", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] }, { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:11476", "recommended_name": { "id": "DOID:11476", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11476", "name": "osteoporosis", "description": "A bone resorption disease characterized by decreased density of normally mineralized bone which results_in the thinning of bone tissue and decreased mechanical strength." }, "synonyms": [ { "id": "MONDO:0005298", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005298", "name": "osteoporosis", "description": "A condition of reduced bone mass, with decreased cortical thickness and a decrease in the number and size of the trabeculae of cancellous bone (but normal chemical composition), resulting in increased fracture incidence. Osteoporosis is classified as primary (Type 1, postmenopausal osteoporosis; Type 2, age-associated osteoporosis; and idiopathic, which can affect juveniles, premenopausal women, and middle-aged men) and secondary osteoporosis (which results from an identifiable cause of bone mass loss)." }, { "id": "MONDO:0005298", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005298", "name": "bone mineral density variation QTL, osteoporosis", "description": "" }, { "id": "MONDO:0005298", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005298", "name": "osteoporosis, postmenopausal", "description": "" }, { "id": "MONDO:0005298", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005298", "name": "osteoporosis, postmenopausal, susceptibility", "description": "" }, { "id": "MONDO:0005298", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005298", "name": "osteoporosis, susceptibility to", "description": "" }, { "id": "MONDO:0005298", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005298", "name": "fracture, hip, susceptibility to", "description": "" }, { "id": "MONDO:0005298", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005298", "name": "osteoporosis, involutional", "description": "" }, { "id": "MIM:166710", "resource": "MIM", "url": "https://www.omim.org/entry/166710", "name": "Osteoporosis", "description": "Osteoporosis" } ], "evidence": [ { "id": "11476", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11476" } ] }, { "disease_id": "DOID:12387", "recommended_name": { "id": "DOID:12387", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12387", "name": "nephrogenic diabetes insipidus", "description": "A diabetes insipidus that is characterized by a complete or partial resistance of the kidneys to vasopressin (ADH)." }, "synonyms": [], "evidence": [ { "id": "12387", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12387" } ] }, { "disease_id": "DOID:12858", "recommended_name": { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "Huntington's disease", "description": "A neurodegenerative disease that has_material_basis_in autosomal dominant inheritance and is characterized by unwanted choreatic movements, behavioral and psychiatric disturbances and dementia and has_material_basis_in expansion of CAG triplet repeats (glutamine) resulting in neuron degeneration affecting muscle coordination, cognitive abilities." }, "synonyms": [ { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "HD", "description": "" }, { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "Huntington disease", "description": "" }, { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "Huntington's chorea", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington disease", "description": "Huntington disease (HD) is a rare neurodegenerative disorder of the central nervous system characterized by unwanted choreatic movements, behavioral and psychiatric disturbances and dementia." }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "HD", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington chorea", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington disease", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington's chorea", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington's disease", "description": "" }, { "id": "MIM:143100", "resource": "MIM", "url": "https://www.omim.org/entry/143100", "name": "Huntington disease", "description": "Huntington disease" } ], "evidence": [ { "id": "12858", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12858" } ] }, { "disease_id": "DOID:14330", "recommended_name": { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson's disease", "description": "A synucleinopathy that has_material_basis_in degeneration of the central nervous system that often impairs motor skills, speech, and other functions." }, "synonyms": [ { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson disease", "description": "" }, { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "paralysis agitans", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "A Parkinson disease that begins after around the age of 50." }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "LOPD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PARK", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, age of onset, modifier, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "autosomal dominant late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson's disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "" }, { "id": "MIM:168600", "resource": "MIM", "url": "https://www.omim.org/entry/168600", "name": "Parkinson disease", "description": "Parkinson disease" } ], "evidence": [ { "id": "14330", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:14330" } ] }, { "disease_id": "DOID:1574", "recommended_name": { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "alcohol use disorder", "description": "A substance abuse that involves the recurring use of alcoholic beverages despite negative consequences." }, "synonyms": [ { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "Ethanol abuse", "description": "" }, { "id": "DOID:1574", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1574", "name": "alcohol abuse", "description": "" } ], "evidence": [ { "id": "1574", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1574" } ] }, { "disease_id": "DOID:1826", "recommended_name": { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epilepsy", "description": "A brain disease that is characterized by the occurrance of at least two unprovoked seizures resulting from a persistent epileptogenic abnormality of the brain that is able to spontaneously generate paroxysmal activity and typically manifested by sudden brief episodes of altered or diminished consciousness, involuntary movements, or convulsions." }, "synonyms": [ { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epilepsy syndrome", "description": "" }, { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epileptic syndrome", "description": "" } ], "evidence": [ { "id": "1826", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1826" } ] }, { "disease_id": "DOID:1875", "recommended_name": { "id": "DOID:1875", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1875", "name": "impotence", "description": "A sexual dysfunction that is characterized by persistent or recurrent inability to achieve or to maintain an erection during sexual activity." }, "synonyms": [ { "id": "DOID:1875", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1875", "name": "Sexual impotence", "description": "" }, { "id": "DOID:1875", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1875", "name": "erectile dysfunction", "description": "" } ], "evidence": [ { "id": "1875", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1875" } ] }, { "disease_id": "DOID:1936", "recommended_name": { "id": "DOID:1936", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1936", "name": "atherosclerosis", "description": "" }, "synonyms": [], "evidence": [ { "id": "1936", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1936" } ] }, { "disease_id": "DOID:3021", "recommended_name": { "id": "DOID:3021", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3021", "name": "acute kidney failure", "description": "" }, "synonyms": [], "evidence": [ { "id": "3021", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3021" } ] }, { "disease_id": "DOID:3525", "recommended_name": { "id": "DOID:3525", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3525", "name": "middle cerebral artery infarction", "description": "" }, "synonyms": [], "evidence": [ { "id": "3525", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3525" } ] }, { "disease_id": "DOID:4448", "recommended_name": { "id": "DOID:4448", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4448", "name": "macular degeneration", "description": "A retinal degeneration characterized by gradual deterioration of light-sensing cells in the tissues at the back of the eye and has_symptom vision loss." }, "synonyms": [ { "id": "DOID:4448", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4448", "name": "Macular degeneration of retina", "description": "" } ], "evidence": [ { "id": "4448", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:4448" } ] }, { "disease_id": "DOID:5844", "recommended_name": { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "myocardial infarction", "description": "A coronary artery disease characterized by myocardial cell death (myocardial necrosis) due to prolonged ischaemia." }, "synonyms": [ { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "Myocardial infarct", "description": "" }, { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "heart attack", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, type 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "Mci2", "description": "" } ], "evidence": [ { "id": "5844", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5844" } ] }, { "disease_id": "DOID:9351", "recommended_name": { "id": "DOID:9351", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9351", "name": "diabetes mellitus", "description": "A glucose metabolism disease that is characterized by chronic hyperglycaemia with disturbances of carbohydrate, fat and protein metabolism resulting from defects in insulin secretion, insulin action, or both." }, "synonyms": [ { "id": "DOID:9351", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9351", "name": "diabetes", "description": "" } ], "evidence": [ { "id": "9351", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9351" } ] }, { "disease_id": "DOID:9352", "recommended_name": { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes mellitus", "description": "A diabetes mellitus that is characterized by high blood sugar, insulin resistance, and relative lack of insulin." }, "synonyms": [ { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "NIDDM", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type 2 diabetes", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "type II diabetes mellitus", "description": "" }, { "id": "DOID:9352", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9352", "name": "insulin resistance", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "diabetes mellitus, noninsulin-dependent, type 4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "Niddm4", "description": "" }, { "id": "MONDO:0011955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011955", "name": "noninsulin-dependent diabetes mellitus 4", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "A type of diabetes mellitus that is characterized by insulin resistance or desensitization and increased blood glucose levels. This is a chronic disease that can develop gradually over the life of a patient and can be linked to both environmental factors and heredity." }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "NIDDM", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "T2DM - type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "adult-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitis type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, association with", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, late onset", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes, type 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, severe, digenic", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "non-insulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin dependent diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "noninsulin-dependent diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus non-insulin dependent", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type II diabetes mellitus", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, non-insulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, noninsulin-dependent, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, protection against", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type 2, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "diabetes mellitus, type II, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "hypertension, insulin resistance-related, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "insulin resistance, susceptibility to", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "maturity-onset diabetes", "description": "" }, { "id": "MONDO:0005148", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005148", "name": "type 2 diabetes mellitus, susceptibility to", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "diabetes mellitus, noninsulin-dependent, type 1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "NIDDM1", "description": "" }, { "id": "MONDO:0011027", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011027", "name": "noninsulin-dependent diabetes mellitus 1", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "NIDDM2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "diabetes mellitus, noninsulin-dependent, 2", "description": "" }, { "id": "MONDO:0011072", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011072", "name": "noninsulin-dependent diabetes mellitus 2", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "diabetes mellitus, noninsulin-dependent, type 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "type 2 diabetes mellitus 3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "NIDDM3", "description": "" }, { "id": "MONDO:0011363", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011363", "name": "noninsulin-dependent diabetes mellitus 3", "description": "" }, { "id": "MIM:125853", "resource": "MIM", "url": "https://www.omim.org/entry/125853", "name": "Type 2 diabetes mellitus", "description": "Type 2 diabetes mellitus" }, { "id": "MIM:601283", "resource": "MIM", "url": "https://www.omim.org/entry/601283", "name": "Type 2 diabetes mellitus 1", "description": "Type 2 diabetes mellitus 1" } ], "evidence": [ { "id": "9352", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9352" } ] }, { "disease_id": "DOID:9452", "recommended_name": { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "steatotic liver disease", "description": "A lipid storage disease characterized by the accumulation of large vacuoles of triglyceride fat in at least 5% of hepatocytes." }, "synonyms": [ { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "SLD", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "fatty liver disease", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "Fatty change of liver", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "Steatosis of liver", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "alcoholic fatty liver", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "hepatic lipidosis", "description": "" }, { "id": "DOID:9452", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9452", "name": "hepatic steatosis", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "visceral steatosis, congenital", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "visceral steatosis, congenital", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "White liver disease", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "fatal neonatal hepatic steatosis", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "fatty liver disease, congenital", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "fatty metamorphosis of viscera", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "steatosis of liver", "description": "" }, { "id": "MONDO:0009220", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009220", "name": "visceral steatosis", "description": "" } ], "evidence": [ { "id": "9452", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9452" } ] }, { "disease_id": "DOID:9669", "recommended_name": { "id": "DOID:9669", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9669", "name": "senile cataract", "description": "A cataract that is characterized by thickening and loss of transparency of the lens with age progression, caused by a multifactorial etiology related to aging." }, "synonyms": [], "evidence": [ { "id": "9669", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9669" } ] }, { "disease_id": "DOID:9970", "recommended_name": { "id": "DOID:9970", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9970", "name": "obesity", "description": "An overnutrition that is characterized by excess body fat, traditionally defined as an elevated ratio of weight to height (specifically 30 kilograms per meter squared), has_material_basis_in a multifactorial etiology related to excess nutrition intake, decreased caloric utilization, and genetic susceptibility, and possibly medications and certain disorders of metabolism, endocrine function, and mental illness." }, "synonyms": [ { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "inherited obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity (disease)", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "leanness, inherited, autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "monogenic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, association with, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, early-onset, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, late-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, mild, early-onset, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, severe, and type II diabetes, Autosomal recessive", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "obesity, susceptibility to, Autosomal recessive", "description": "" }, { "id": "MIM:601665", "resource": "MIM", "url": "https://www.omim.org/entry/601665", "name": "Obesity", "description": "Obesity" } ], "evidence": [ { "id": "9970", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9970" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "common_name": "Rat" } ], "gene": [ { "name": "Sirt1", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79", "locus": { "chromosome": "20", "start_pos": 25329260, "end_pos": 25306917, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000051592", "url": "https://www.ensembl.org/id/ENSRNOG00000051592" } ] } } ], "crossref": [ { "id": "ENSRNOG00000051592", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000051592", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd01408", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01408", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "A0A0G2JZ79", "url": "https://www.ebi.ac.uk/intact/interactors/id:A0A0G2JZ79*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003000", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003000", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR026590", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026590", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR026591", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026591", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029035", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029035", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "KRYWMSR", "url": "https://omabrowser.org/oma/group/KRYWMSR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR47651", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47651", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47651:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47651:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02146", "url": "http://pfam.xfam.org/family/PF02146", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0A0G2JZ79", "url": "http://purl.obolibrary.org/obo/PR_A0A0G2JZ79", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3371453", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-427359", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-427359", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-9617629", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9617629", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "1308542", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1308542", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "23500", "url": "https://www.rhea-db.org/rhea/23500", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "43636", "url": "https://www.rhea-db.org/rhea/43636", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "69332", "url": "https://www.rhea-db.org/rhea/69332", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JZ79-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A182DWI7", "url": "https://www.uniprot.org/uniprot/A0A182DWI7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A182DWI7-1", "url": "https://www.uniprot.org/uniprot/A0A182DWI7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A306", "url": "https://www.uniprot.org/uniprot/A0A8I6A306", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A306-1", "url": "https://www.uniprot.org/uniprot/A0A8I6A306-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AMW7", "url": "https://www.uniprot.org/uniprot/A0A8I6AMW7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AMW7-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AMW7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6B0Z5", "url": "https://www.uniprot.org/uniprot/A0A8I6B0Z5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6B0Z5-1", "url": "https://www.uniprot.org/uniprot/A0A8I6B0Z5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELVHLSELPPTPLHISEDSSSPERTVPQDSSVIATLVDQTIKNKVDDLEVSEPKSCVEEKSQEVQTYRNVESINVENPDFKAVGSSTGDKNERTSVAETVRKCWPNRLAKEQISKRLDGNQYLFVPPNRYIFHGAEVYSDSEDDALSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDADRPECAGGSGADGGDQEAVNEAIAMKQELTDVNCTPDKSEHY", "length": 555, "header": "sp|A0A0G2JZ79-1|SIR1_RAT Isoform 1 of NAD-dependent protein deacetylase sirtuin-1 OS=Rattus norvegicus OX=10116 GN=Sirt1 PE=3 SV=2 CANONICAL=A0A0G2JZ79-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JZ79-1", "url": "", "sequence": { "sequence": "MIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELVHLSELPPTPLHISEDSSSPERTVPQDSSVIATLVDQTIKNKVDDLEVSEPKSCVEEKSQEVQTYRNVESINVENPDFKAVGSSTGDKNERTSVAETVRKCWPNRLAKEQISKRLDGNQYLFVPPNRYIFHGAEVYSDSEDDALSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDADRPECAGGSGADGGDQEAVNEAIAMKQELTDVNCTPDKSEHY", "length": 555, "header": "sp|A0A0G2JZ79-1|SIR1_RAT Isoform 1 of NAD-dependent protein deacetylase sirtuin-1 OS=Rattus norvegicus OX=10116 GN=Sirt1 PE=3 SV=2 CANONICAL=A0A0G2JZ79-1" }, "locus": {} }, { "isoform_ac": "A0A182DWI7-1", "url": "", "sequence": { "sequence": "MADEAALALQAGGSPSAAAAMEAASQPADEPLRKRPRRDGPGLGRSPGEPSAAAAAAAAAAGCEAASAAAPAALWREAAGAAAASAEREAPATAAAGDGDNGPGLRREPRAADDFDDDEGEEEDEAAAAAAAAIGYRDNLLLADEIITNGFHSCESDDDDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSNQYLFVPPNRYIFHGAEVYSDSEDDALSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDADRPECAGGSGADGGDQEAVNEAIAMKQELTDVNCTPDKSE", "length": 554, "header": "tr|A0A182DWI7-1|SIR1_RAT Computationally mapped isoform of NAD-dependent protein deacetylase sirtuin-1 OS=Rattus norvegicus OX=10116 GN=Sirt1 PE=3 SV=2 CANONICAL=A0A0G2JZ79-1" }, "locus": { "chromosome": "20", "start_pos": 25327667, "end_pos": 25307287, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000078739.2", "url": "https://www.ensembl.org/id/ENSRNOT00000078739.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000070943.2", "url": "https://www.ensembl.org/id/ENSRNOP00000070943.2" } ] } }, { "isoform_ac": "A0A8I6A306-1", "url": "", "sequence": { "sequence": "MADEAALALQAGGSPSAAAAMEAASQPADEPLRKRPRRDGPGLGRSPGEPSAAAAAAAAAAGCEAASAAAPAALWREAAGAAAASAEREAPATAAAGDGDNGPGLRREPRAADDFDDDEGEEEDEAAAAAAAAIGYRDNLLLADEIITNGFHSCESDDDDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELVHLSELPPTPLHISEDSSSPERTVPQDSSVIATLVDQTIKNKVDDLEVSEPKSCVEEKSQEVQTYRNVESINVENPDFKAVGSSTGDKNERTSVAETVRKCWPNRLAKEQISKRLDGNQYLFVPPNRYIFHGAEVYSDSEDDALSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDADRPECAGGSGADGGDQEAVNEAIAMKQELTDVNCTPDKSEHY", "length": 741, "header": "tr|A0A8I6A306-1|A0A8I6A306_RAT Computationally mapped isoform of Sirtuin 1 OS=Rattus norvegicus OX=10116 GN=Sirt1 PE=4 SV=1 CANONICAL=A0A0G2JZ79-1" }, "locus": { "chromosome": "20", "start_pos": 25327673, "end_pos": 25307287, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000095567.1", "url": "https://www.ensembl.org/id/ENSRNOT00000095567.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000086140.1", "url": "https://www.ensembl.org/id/ENSRNOP00000086140.1" } ] } }, { "isoform_ac": "A0A8I6AMW7-1", "url": "", "sequence": { "sequence": "MADEAALALQAGGSPSAAAAMEAASQPADEPLRKRPRRDGPGLGRSPGEPSAAAAAAAAAAGCEAASAAAPAALWREAAGAAAASAEREAPATAAAGDGDNGPGLRREPRAADDFDDDEGEEEDEAAAAAAAAIGYRGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELVHLSELPPTPLHISEDSSSPERTVPQDSSVIATLVDQTIKNKVDDLEVSEPKSCVEEKSQEVQTYRNVESINVENPDFKAVGSSTGDKNERTSVAETVRKCWPNRLAKEQISKRLDGNQYLFVPPNRYIFHGAEVYSDSEDDALSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDADRPECAGGSGADGGDQEAVNEAIAMKQELTDVNCTPDKSEHY", "length": 702, "header": "tr|A0A8I6AMW7-1|A0A8I6AMW7_RAT Computationally mapped isoform of Sirtuin 1 OS=Rattus norvegicus OX=10116 GN=Sirt1 PE=4 SV=1 CANONICAL=A0A0G2JZ79-1" }, "locus": { "chromosome": "20", "start_pos": 25327673, "end_pos": 25307287, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000111766.1", "url": "https://www.ensembl.org/id/ENSRNOT00000111766.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000094805.1", "url": "https://www.ensembl.org/id/ENSRNOP00000094805.1" } ] } }, { "isoform_ac": "A0A8I6B0Z5-1", "url": "", "sequence": { "sequence": "MCLCSGRKAILEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELVHLSELPPTPLHISEDSSSPERTVPQDSSVIATLVDQTIKNKVDDLEVSEPKSCVEEKSQEVQTYRNVESINVENPDFKAVGSSTGDKNERTSVAETVRKCWPNRLAKEQISKRLDGNQYLFVPPNRYIFHGAEVYSDSEDDALSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDADRPECAGGSGADGGDQEAVNEAIAMKQELTDVNCTPDKSEHY", "length": 444, "header": "tr|A0A8I6B0Z5-1|A0A8I6B0Z5_RAT Computationally mapped isoform of Sirtuin 1 OS=Rattus norvegicus OX=10116 GN=Sirt1 PE=4 SV=1 CANONICAL=A0A0G2JZ79-1" }, "locus": { "chromosome": "20", "start_pos": 25327673, "end_pos": 25320540, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000119601.1", "url": "https://www.ensembl.org/id/ENSRNOT00000119601.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000094468.1", "url": "https://www.ensembl.org/id/ENSRNOP00000094468.1" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 338, "end_pos": 338, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "site_lbl": "Thr338" }, { "start_pos": 343, "end_pos": 343, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "site_lbl": "Ser343" }, { "start_pos": 352, "end_pos": 352, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "site_lbl": "Thr352" }, { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "site_lbl": "Ser466" }, { "start_pos": 468, "end_pos": 468, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "site_lbl": "Ser468" }, { "start_pos": 552, "end_pos": 552, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "site_lbl": "Ser552" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "R-RNO-3371453", "name": "Regulation of HSF1-mediated heat shock response", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3371453", "resource": "Reactome", "description": "Regulation of HSF1-mediated heat shock response" }, { "id": "R-RNO-427359", "name": "SIRT1 negatively regulates rRNA expression", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-427359", "resource": "Reactome", "description": "SIRT1 negatively regulates rRNA expression" }, { "id": "R-RNO-9617629", "name": "Regulation of FOXO transcriptional activity by acetylation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9617629", "resource": "Reactome", "description": "Regulation of FOXO transcriptional activity by acetylation" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 145, "go_terms": [ { "name": "regulation of centrosome duplication", "id": "GO:0010824", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010824", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of reactive oxygen species biosynthetic process", "id": "GO:1903427", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903427", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "regulation of bile acid biosynthetic process", "id": "GO:0070857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070857", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of helicase activity", "id": "GO:0051097", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051097", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "stress-induced premature senescence", "id": "GO:0090400", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090400", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "pyrimidine dimer repair by nucleotide-excision repair", "id": "GO:0000720", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000720", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of adipose tissue development", "id": "GO:1904179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904179", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of cAMP-dependent protein kinase activity", "id": "GO:2000480", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000480", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of growth hormone secretion", "id": "GO:0060125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060125", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of prostaglandin biosynthetic process", "id": "GO:0031393", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031393", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of skeletal muscle cell proliferation", "id": "GO:0014858", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014858", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "behavioral response to starvation", "id": "GO:0042595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042595", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of histone H3-K9 trimethylation", "id": "GO:1900113", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900113", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of thyroid-stimulating hormone secretion", "id": "GO:2000614", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000614", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "angiogenesis", "id": "GO:0001525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001525", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of protein phosphorylation", "id": "GO:0001934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "response to oxidative stress", "id": "GO:0006979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006979", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of cholesterol efflux", "id": "GO:0010875", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010875", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of neuron projection development", "id": "GO:0010976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010976", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "regulation of cell population proliferation", "id": "GO:0042127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042127", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0043280", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043280", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "response to ethanol", "id": "GO:0045471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045471", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "white fat cell differentiation", "id": "GO:0050872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050872", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "neuron apoptotic process", "id": "GO:0051402", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051402", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of protein localization to nucleus", "id": "GO:1900181", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900181", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cellular response to amyloid-beta", "id": "GO:1904646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904646", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "regulation of glucose metabolic process", "id": "GO:0010906", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010906", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "response to nutrient levels", "id": "GO:0031667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031667", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of tumor necrosis factor production", "id": "GO:0032720", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032720", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of insulin secretion involved in cellular response to glucose stimulus", "id": "GO:0035774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035774", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "vasodilation", "id": "GO:0042311", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042311", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of angiogenesis", "id": "GO:0045766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045766", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "energy homeostasis", "id": "GO:0097009", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097009", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "transforming growth factor beta receptor signaling pathway", "id": "GO:0007179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007179", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "response to hydrogen peroxide", "id": "GO:0042542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042542", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of neuron apoptotic process", "id": "GO:0043524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043524", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cellular response to hypoxia", "id": "GO:0071456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071456", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cellular response to leukemia inhibitory factor", "id": "GO:1990830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990830", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "DNA damage response", "id": "GO:0006974", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "regulation of mitotic cell cycle", "id": "GO:0007346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007346", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "muscle organ development", "id": "GO:0007517", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007517", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of heart rate", "id": "GO:0010460", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010460", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of NF-kappaB transcription factor activity", "id": "GO:0032088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032088", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cholesterol homeostasis", "id": "GO:0042632", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042632", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator", "id": "GO:0042771", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042771", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "fatty acid homeostasis", "id": "GO:0055089", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055089", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of endothelial cell proliferation", "id": "GO:0001938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001938", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "circadian rhythm", "id": "GO:0007623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007623", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "intrinsic apoptotic signaling pathway in response to DNA damage", "id": "GO:0008630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008630", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of cell growth", "id": "GO:0030308", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030308", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of histone deacetylation", "id": "GO:0031065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031065", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "response to insulin", "id": "GO:0032868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032868", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of I-kappaB kinase/NF-kappaB signaling", "id": "GO:0043124", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043124", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of DNA repair", "id": "GO:0045739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045739", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cellular response to hydrogen peroxide", "id": "GO:0070301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070301", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of cellular senescence", "id": "GO:2000773", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000773", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "intracellular glucose homeostasis", "id": "GO:0001678", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001678", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of TOR signaling", "id": "GO:0032007", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032007", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cellular response to glucose starvation", "id": "GO:0042149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042149", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of cAMP-dependent protein kinase activity", "id": "GO:2000481", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000481", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "chromatin organization", "id": "GO:0006325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006325", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of macroautophagy", "id": "GO:0016239", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016239", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "regulation of apoptotic process", "id": "GO:0042981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042981", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "single strand break repair", "id": "GO:0000012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000012", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of blood vessel endothelial cell migration", "id": "GO:0043536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043536", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway", "id": "GO:1902237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902237", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cellular response to starvation", "id": "GO:0009267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009267", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of cell growth involved in cardiac muscle cell development", "id": "GO:0061051", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061051", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of fat cell differentiation", "id": "GO:0045599", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045599", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of insulin receptor signaling pathway", "id": "GO:0046628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046628", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "regulation of lipid storage", "id": "GO:0010883", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010883", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of transforming growth factor beta receptor signaling pathway", "id": "GO:0030512", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030512", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "circadian regulation of gene expression", "id": "GO:0032922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032922", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cellular response to tumor necrosis factor", "id": "GO:0071356", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071356", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cellular response to organic cyclic compound", "id": "GO:0071407", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071407", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway", "id": "GO:1902176", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902176", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of cell cycle", "id": "GO:0045786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045786", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of protein kinase B signaling", "id": "GO:0051898", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051898", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "triglyceride mobilization", "id": "GO:0006642", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006642", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of cardiac muscle cell apoptotic process", "id": "GO:0010667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010667", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase signaling", "id": "GO:0014068", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014068", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cardiac muscle cell apoptotic process", "id": "GO:0010659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010659", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "protein destabilization", "id": "GO:0031648", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031648", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of phosphorylation", "id": "GO:0042326", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042326", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cellular response to antibiotic", "id": "GO:0071236", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071236", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of adaptive immune response", "id": "GO:0002821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002821", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "UV-damage excision repair", "id": "GO:0070914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070914", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cellular response to ionizing radiation", "id": "GO:0071479", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071479", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of fibroblast apoptotic process", "id": "GO:2000270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000270", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of cellular senescence", "id": "GO:2000774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000774", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "rDNA heterochromatin formation", "id": "GO:0000183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000183", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "histone deacetylation", "id": "GO:0016575", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016575", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "response to fluoride", "id": "GO:1902617", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902617", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of DNA damage response, signal transduction by p53 class mediator", "id": "GO:0043518", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043518", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of macrophage cytokine production", "id": "GO:0060907", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060907", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of triglyceride biosynthetic process", "id": "GO:0010868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010868", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "protein deacetylation", "id": "GO:0006476", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006476", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of peptidyl-lysine acetylation", "id": "GO:2000757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000757", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "response to kainic acid", "id": "GO:1904373", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904373", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "DNA synthesis involved in DNA repair", "id": "GO:0000731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000731", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of gluconeogenesis", "id": "GO:0045722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045722", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "histone H3 deacetylation", "id": "GO:0070932", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070932", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator", "id": "GO:1902166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902166", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "intracellular triglyceride homeostasis", "id": "GO:0035356", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035356", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of macrophage apoptotic process", "id": "GO:2000111", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000111", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "regulation of brown fat cell differentiation", "id": "GO:0090335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090335", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of double-strand break repair", "id": "GO:2000781", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000781", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "regulation of protein serine/threonine kinase activity", "id": "GO:0071900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071900", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of cellular response to testosterone stimulus", "id": "GO:2000655", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000655", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "heterochromatin formation", "id": "GO:0031507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031507", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of DNA-binding transcription factor activity", "id": "GO:0043433", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043433", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of protein deacetylation", "id": "GO:0090312", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090312", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "peptidyl-lysine acetylation", "id": "GO:0018394", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018394", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "macrophage differentiation", "id": "GO:0030225", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030225", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of MHC class II biosynthetic process", "id": "GO:0045348", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045348", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of histone methylation", "id": "GO:0031062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031062", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "ovulation from ovarian follicle", "id": "GO:0001542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001542", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "response to mycotoxin", "id": "GO:0010046", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010046", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "response to leptin", "id": "GO:0044321", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044321", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of androgen receptor signaling pathway", "id": "GO:0060766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060766", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "regulation of peroxisome proliferator activated receptor signaling pathway", "id": "GO:0035358", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035358", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "regulation of endodeoxyribonuclease activity", "id": "GO:0032071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032071", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "regulation of transcription by glucose", "id": "GO:0046015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046015", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of DNA binding", "id": "GO:0043392", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043392", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "regulation of smooth muscle cell apoptotic process", "id": "GO:0034391", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034391", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "peptidyl-lysine deacetylation", "id": "GO:0034983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034983", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "leptin-mediated signaling pathway", "id": "GO:0033210", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033210", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "negative regulation of protein acetylation", "id": "GO:1901984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901984", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "positive regulation of smooth muscle cell differentiation", "id": "GO:0051152", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051152", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cellular response to vitamin B3", "id": "GO:0071303", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071303", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "response to resveratrol", "id": "GO:1904638", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904638", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cellular response to curcumin", "id": "GO:1904644", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904644", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cellular response to rotenone", "id": "GO:1904648", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904648", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "protein depropionylation", "id": "GO:0106230", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106230", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "maintenance of nucleus location", "id": "GO:0051658", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051658", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 32, "go_terms": [ { "name": "keratin filament binding", "id": "GO:1990254", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990254", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "transcription coactivator activity", "id": "GO:0003713", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003713", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "enzyme inhibitor activity", "id": "GO:0004857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004857", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "enzyme activator activity", "id": "GO:0008047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008047", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "transcription corepressor activity", "id": "GO:0003714", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003714", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "mitogen-activated protein kinase binding", "id": "GO:0051019", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051019", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "NAD+ binding", "id": "GO:0070403", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070403", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "deacetylase activity", "id": "GO:0019213", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019213", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "phosphatase inhibitor activity", "id": "GO:0019212", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019212", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "histone binding", "id": "GO:0042393", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042393", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "protein kinase B binding", "id": "GO:0043422", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043422", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "p53 binding", "id": "GO:0002039", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002039", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "histone deacetylase activity", "id": "GO:0004407", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004407", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "nuclear receptor binding", "id": "GO:0016922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016922", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "bHLH transcription factor binding", "id": "GO:0043425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043425", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "NAD-dependent histone deacetylase activity", "id": "GO:0017136", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017136", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "protein lysine deacetylase activity", "id": "GO:0033558", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033558", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "HLH domain binding", "id": "GO:0043398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043398", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "NAD-dependent protein deacetylase activity", "id": "GO:0034979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034979", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "NAD-dependent histone H3K9 deacetylase activity", "id": "GO:0046969", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046969", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "promoter-specific chromatin binding", "id": "GO:1990841", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990841", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "NAD-dependent histone decrotonylase activity", "id": "GO:0160012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0160012", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "DNA-binding transcription factor binding", "id": "GO:0140297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140297", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "protein-propionyllysine depropionylase activity", "id": "GO:0106231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106231", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "transcription regulator activator activity", "id": "GO:0140537", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140537", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "molecular function activator activity", "id": "GO:0140677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140677", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "transferase activity", "id": "GO:0016740", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016740", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 20, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "nuclear envelope", "id": "GO:0005635", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005635", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "axon", "id": "GO:0030424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030424", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "growth cone", "id": "GO:0030426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030426", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "PML body", "id": "GO:0016605", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016605", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "euchromatin", "id": "GO:0000791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000791", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "chromatin silencing complex", "id": "GO:0005677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005677", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "rDNA heterochromatin", "id": "GO:0033553", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033553", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "nuclear inner membrane", "id": "GO:0005637", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005637", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "heterochromatin", "id": "GO:0000792", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000792", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "eNoSc complex", "id": "GO:0061773", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061773", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "fibrillar center", "id": "GO:0001650", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001650", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" }, { "name": "ESC/E(Z) complex", "id": "GO:0035098", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035098", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZ79", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 150, "end_pos": 152, "annotation": "n_glycosylation_sequon" }, { "start_pos": 546, "end_pos": 548, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "23500", "name": "", "equation": "H2O + N(6)-propanoyl-L-lysyl-[protein] + NAD(+) = 3''-O-propanoyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2JZ79-1", "B2RZ55-1", "Q96EB6-1", "Q9NRC8-1", "Q923E4-1", "Q8BKJ9-1" ], "evidence": [ { "id": "23500", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/23500" } ] }, { "id": "43636", "name": "", "equation": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5RJQ4-1", "A0A0G2JZ79-1", "B2RZ55-1", "G3V641-1", "A0A8I5XWT5-1", "Q9NTG7-1", "Q96EB6-1", "Q8IXJ6-1", "Q8N6T7-1", "Q9NRC8-1", "Q9Y6E7-1", "P59941-1", "Q8VDQ8-1", "Q923E4-1", "Q8R216-1", "Q8R104-1", "Q8BKJ9-1", "P06700-1", "P53686-1", "P53688-1", "P53685-1", "P53687-1", "Q54LF0-1", "Q54P49-1", "Q54GV7-1", "Q54QE6-1", "Q55DB0-1", "Q9VAQ1-1", "Q8IRR5-1", "Q9I7I7-1", "Q9VH08-1", "Q9VK34-1" ], "evidence": [ { "id": "43636", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/43636" } ] }, { "id": "69332", "name": "", "equation": "H2O + N(6)-(2E)-butenoyl-L-lysyl-[protein] + NAD(+) = 2''-O-(2E)-but-2-enoyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2JZ79-1", "Q96EB6-1", "Q923E4-1" ], "evidence": [ { "id": "69332", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/69332" } ] }, { "id": "R-RNO-3371467", "name": "SIRT1 deacetylates HSF1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [ "R-ALL-427497", "R-ALL-427498" ], "enzyme_list": [ "P63018-1", "A0A0G2JZ79-1" ], "evidence": [ { "id": "R-RNO-3371467", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3371467" } ] }, { "id": "R-RNO-3371518", "name": "SIRT1 binds to HSF1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P63018-1", "A0A0G2JZ79-1" ], "evidence": [ { "id": "R-RNO-3371518", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-3371518" } ] }, { "id": "R-RNO-427514", "name": "eNoSC deacetylates histone H3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2JZ79-1", "Q5U4F0-1" ], "evidence": [ { "id": "R-RNO-427514", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-427514" } ] }, { "id": "R-RNO-427527", "name": "eNoSC dimethylates histone H3 at lysine-9", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2JZ79-1", "Q5U4F0-1" ], "evidence": [ { "id": "R-RNO-427527", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-427527" } ] }, { "id": "R-RNO-427528", "name": "Formation of energy-dependent Nucleolar Silencing Complex (eNoSC)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2JZ79-1", "Q5U4F0-1" ], "evidence": [ { "id": "R-RNO-427528", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-427528" } ] }, { "id": "R-RNO-9620532", "name": "SIRT1,SIRT3 deacetylate FOXO3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [ "R-RNO-9620514" ], "output_participant_list": [ "R-RNO-199305" ], "enzyme_list": [ "A0A0G2JZ79-1" ], "evidence": [ { "id": "R-RNO-9620532", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-9620532" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-427497", "participant_name": "NAM [nucleoplasm]", "crossref": [ { "id": "C00153", "database": "COMPOUND", "url": "" }, { "id": "17154", "database": "ChEBI", "url": "" }, { "id": "HMDB0001406", "database": "HMDB Metabolite", "url": "" }, { "id": "000000005878", "database": "ZINC", "url": "" }, { "id": "C00153", "database": "COMPOUND", "url": "" }, { "id": "17154", "database": "ChEBI", "url": "" }, { "id": "HMDB0001406", "database": "HMDB Metabolite", "url": "" }, { "id": "000000005878", "database": "ZINC", "url": "" }, { "id": "C00153", "database": "COMPOUND", "url": "" }, { "id": "17154", "database": "ChEBI", "url": "" }, { "id": "HMDB0001406", "database": "HMDB Metabolite", "url": "" }, { "id": "000000005878", "database": "ZINC", "url": "" }, { "id": "C00153", "database": "COMPOUND", "url": "" }, { "id": "17154", "database": "ChEBI", "url": "" }, { "id": "HMDB0001406", "database": "HMDB Metabolite", "url": "" }, { "id": "000000005878", "database": "ZINC", "url": "" }, { "id": "000000005878", "database": "ZINC", "url": "" }, { "id": "HMDB0001406", "database": "HMDB Metabolite", "url": "" }, { "id": "17154", "database": "ChEBI", "url": "" }, { "id": "C00153", "database": "COMPOUND", "url": "" }, { "id": "C00153", "database": "COMPOUND", "url": "" }, { "id": "17154", "database": "ChEBI", "url": "" }, { "id": "HMDB0001406", "database": "HMDB Metabolite", "url": "" }, { "id": "000000005878", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-427498", "participant_name": "2'-O-acetyl-ADP-ribose [nucleoplasm]", "crossref": [ { "id": "76279", "database": "ChEBI", "url": "" }, { "id": "6333", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000096095472", "database": "ZINC", "url": "" }, { "id": "000058638658", "database": "ZINC", "url": "" }, { "id": "76279", "database": "ChEBI", "url": "" }, { "id": "6333", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000096095472", "database": "ZINC", "url": "" }, { "id": "000058638658", "database": "ZINC", "url": "" }, { "id": "76279", "database": "ChEBI", "url": "" }, { "id": "6333", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000096095472", "database": "ZINC", "url": "" }, { "id": "000058638658", "database": "ZINC", "url": "" }, { "id": "000058638658", "database": "ZINC", "url": "" }, { "id": "76279", "database": "ChEBI", "url": "" }, { "id": "000096095472", "database": "ZINC", "url": "" }, { "id": "6333", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "76279", "database": "ChEBI", "url": "" }, { "id": "6333", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "000096095472", "database": "ZINC", "url": "" }, { "id": "000058638658", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-RNO-199305", "participant_name": "Foxo3 [nucleoplasm]", "crossref": [ { "id": "D3ZBQ1", "database": "UniProt", "url": "" }, { "id": "ENSRNOP00000000327", "database": "Ensembl", "url": "" }, { "id": "ENSRNOG00000000299", "database": "Ensembl", "url": "" }, { "id": "NP_001099865.1", "database": "RefSeq", "url": "" }, { "id": "ENSRNOT00000000327", "database": "Ensembl", "url": "" }, { "id": "1309196", "database": "RGD", "url": "" } ] }, { "participant_id": "R-RNO-9620514", "participant_name": "Foxo3 [nucleoplasm]", "crossref": [ { "id": "ENSRNOG00000000299", "database": "Ensembl", "url": "" }, { "id": "ENSRNOT00000000327", "database": "Ensembl", "url": "" }, { "id": "D3ZBQ1", "database": "UniProt", "url": "" }, { "id": "1309196", "database": "RGD", "url": "" }, { "id": "NP_001099865.1", "database": "RefSeq", "url": "" }, { "id": "ENSRNOP00000000327", "database": "Ensembl", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JZ79", "gene_name": "Sirt1", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "A0A0G2JZ79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ] }, { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "A0A0G2JZ79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "A0A0G2JZ79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ79" } ] } ] }, { "uniprot_ac": "A0A8I5XWT5", "gene_name": "Sirt3", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "A0A8I5XWT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5XWT5" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "A0A8I5XWT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5XWT5" } ] } ] }, { "uniprot_ac": "B2RZ55", "gene_name": "Sirt7", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "B2RZ55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RZ55" } ] }, { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "B2RZ55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RZ55" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "B2RZ55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RZ55" } ] } ] }, { "uniprot_ac": "G3V641", "gene_name": "Sirt4", "activity": [ { "ec_number": "2.4.2.-", "activity": "", "evidence": [ { "id": "G3V641", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V641" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "G3V641", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V641" } ] }, { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "G3V641", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V641" } ] } ] }, { "uniprot_ac": "P06700", "gene_name": "SIR2", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "P06700", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06700" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "P06700", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06700" } ] } ] }, { "uniprot_ac": "P53685", "gene_name": "HST1", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "P53685", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53685" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "P53685", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53685" } ] } ] }, { "uniprot_ac": "P53686", "gene_name": "HST2", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "P53686", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53686" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "P53686", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53686" } ] } ] }, { "uniprot_ac": "P53687", "gene_name": "HST3", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "P53687", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53687" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "P53687", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53687" } ] } ] }, { "uniprot_ac": "P53688", "gene_name": "HST4", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "P53688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53688" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "P53688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53688" } ] } ] }, { "uniprot_ac": "P59941", "gene_name": "Sirt6", "activity": [ { "ec_number": "2.4.2.-", "activity": "", "evidence": [ { "id": "P59941", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59941" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "P59941", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59941" } ] }, { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "P59941", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P59941" } ] } ] }, { "uniprot_ac": "P63018", "gene_name": "Hspa8", "activity": [ { "ec_number": "3.6.4.10", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P63018", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63018" } ] }, { "ec_number": "3.6.4.10", "activity": "", "evidence": [ { "id": "P63018", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63018" } ] } ] }, { "uniprot_ac": "Q54GV7", "gene_name": "sir2D", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q54GV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GV7" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q54GV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54GV7" } ] } ] }, { "uniprot_ac": "Q54LF0", "gene_name": "sir2B", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q54LF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54LF0" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q54LF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54LF0" } ] } ] }, { "uniprot_ac": "Q54P49", "gene_name": "sir2C", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q54P49", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54P49" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q54P49", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54P49" } ] } ] }, { "uniprot_ac": "Q54QE6", "gene_name": "sir2A", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q54QE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QE6" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q54QE6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QE6" } ] } ] }, { "uniprot_ac": "Q55DB0", "gene_name": "sir2E", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q55DB0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DB0" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q55DB0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55DB0" } ] } ] }, { "uniprot_ac": "Q5RJQ4", "gene_name": "Sirt2", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q5RJQ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RJQ4" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q5RJQ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RJQ4" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q5RJQ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RJQ4" } ] } ] }, { "uniprot_ac": "Q5U4F0", "gene_name": "Rrp8", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q5U4F0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U4F0" } ] } ] }, { "uniprot_ac": "Q8BKJ9", "gene_name": "Sirt7", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8BKJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BKJ9" } ] }, { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q8BKJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BKJ9" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q8BKJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BKJ9" } ] } ] }, { "uniprot_ac": "Q8IRR5", "gene_name": "Sirt4", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q8IRR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IRR5" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q8IRR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IRR5" } ] } ] }, { "uniprot_ac": "Q8IXJ6", "gene_name": "SIRT2", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8IXJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IXJ6" } ] }, { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q8IXJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IXJ6" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q8IXJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IXJ6" } ] } ] }, { "uniprot_ac": "Q8N6T7", "gene_name": "SIRT6", "activity": [ { "ec_number": "2.4.2.-", "activity": "", "evidence": [ { "id": "Q8N6T7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N6T7" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8N6T7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N6T7" } ] }, { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q8N6T7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N6T7" } ] } ] }, { "uniprot_ac": "Q8R104", "gene_name": "Sirt3", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q8R104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R104" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q8R104", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R104" } ] } ] }, { "uniprot_ac": "Q8R216", "gene_name": "Sirt4", "activity": [ { "ec_number": "2.4.2.-", "activity": "", "evidence": [ { "id": "Q8R216", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R216" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8R216", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R216" } ] }, { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q8R216", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R216" } ] } ] }, { "uniprot_ac": "Q8VDQ8", "gene_name": "Sirt2", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8VDQ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VDQ8" } ] }, { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q8VDQ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VDQ8" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q8VDQ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VDQ8" } ] } ] }, { "uniprot_ac": "Q923E4", "gene_name": "Sirt1", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q923E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q923E4" } ] }, { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q923E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q923E4" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q923E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q923E4" } ] } ] }, { "uniprot_ac": "Q96EB6", "gene_name": "SIRT1", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q96EB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EB6" } ] }, { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q96EB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EB6" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q96EB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96EB6" } ] } ] }, { "uniprot_ac": "Q9I7I7", "gene_name": "Sirt2", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q9I7I7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9I7I7" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q9I7I7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9I7I7" } ] } ] }, { "uniprot_ac": "Q9NRC8", "gene_name": "SIRT7", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9NRC8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRC8" } ] }, { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q9NRC8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRC8" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q9NRC8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRC8" } ] } ] }, { "uniprot_ac": "Q9NTG7", "gene_name": "SIRT3", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q9NTG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NTG7" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q9NTG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NTG7" } ] } ] }, { "uniprot_ac": "Q9VAQ1", "gene_name": "Sirt7", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q9VAQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VAQ1" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q9VAQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VAQ1" } ] } ] }, { "uniprot_ac": "Q9VH08", "gene_name": "Sirt6", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q9VH08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH08" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q9VH08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH08" } ] } ] }, { "uniprot_ac": "Q9VK34", "gene_name": "Sirt1", "activity": [ { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q9VK34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VK34" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "Q9VK34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VK34" } ] } ] }, { "uniprot_ac": "Q9Y6E7", "gene_name": "SIRT4", "activity": [ { "ec_number": "2.4.2.-", "activity": "", "evidence": [ { "id": "Q9Y6E7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6E7" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9Y6E7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6E7" } ] }, { "ec_number": "2.3.1.286", "activity": "H2O + N(6)-acetyl-L-lysyl-[protein] + NAD(+) = 2''-O-acetyl-ADP-D-ribose + L-lysyl-[protein] + nicotinamide.", "evidence": [ { "id": "Q9Y6E7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6E7" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }