{ "uniprot_canonical_ac": "A0A0G2JYC1-1", "uniprot_ac": "A0A0G2JYC1", "uniprot_id": "A0A0G2JYC1_RAT", "mass": { "chemical_mass": 34285.0, "monoisotopic_mass": 34285.0 }, "refseq": { "ac": "NP_001000432", "name": "olfactory receptor Olr1151", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000432" }, "gene_names": [ { "name": "Or7g33", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2JYC1", "id": "A0A0G2JYC1" }, { "name": "Olr1151", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000432", "id": "NP_001000432" }, { "name": "Or7g33", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000432", "id": "NP_001000432" } ], "protein_names": [ { "name": "Olfactory receptor 1151", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2JYC1" }, { "name": "olfactory receptor Olr1151", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000432", "id": "NP_001000432" }, { "name": "olfactory receptor gene Olr1151; olfactory receptor 1151", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000432", "id": "NP_001000432" } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001000432", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000432" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYC1", "url": "https://www.uniprot.org/uniprot/A0A0G2JYC1" } ], "common_name": "Rat" } ], "gene": [ { "name": "Or7g33", "url": "https://www.uniprot.org/uniprot/A0A0G2JYC1", "locus": {} } ], "crossref": [ { "id": "cd15234", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15234", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "300411", "url": "https://www.ncbi.nlm.nih.gov/gene/300411", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:300411", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:300411", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PLLRIIC", "url": "https://omabrowser.org/oma/group/PLLRIIC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5401587at2759", "url": "http://www.orthodb.org/?query=5401587at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR48001", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48001", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48001:SF127", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48001:SF127", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_001000432", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000432", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1334193", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1334193", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2JYC1", "url": "https://www.uniprot.org/uniprot/A0A0G2JYC1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JYC1-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JYC1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MELKNQTTVIEFFLLRLSENPELQPILFGLFLLMYLLTVSGNLLIILAIVSDSHLHTPMYFFLSNLSFNDICFSTTTVPKMLINLQKQSKAISYTGCVTQLSFVLLFAGMEDFLLAAMAYDRYVAICKPLHYTAIMKTHLCLVMILLSLCISIVDALLHGLMILRLSFCTFLEIPHYFCELDQVIKLACSDTLINNILVYTMTIALGGVPLVGIIFSYFKIISSILRMPSSGGRHKTFSTCGSHLSVVSLFYGTAFGIYISSAFTESYRQTSVASLMYTVIPPMLNPFIYSLRSKDMKKALRKII", "length": 305, "header": "tr|A0A0G2JYC1-1|A0A0G2JYC1_RAT Isoform 1 of Olfactory receptor 1151 OS=Rattus norvegicus OX=10116 GN=Or7g33 PE=4 SV=1 CANONICAL=A0A0G2JYC1-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JYC1-1", "url": "", "sequence": { "sequence": "MELKNQTTVIEFFLLRLSENPELQPILFGLFLLMYLLTVSGNLLIILAIVSDSHLHTPMYFFLSNLSFNDICFSTTTVPKMLINLQKQSKAISYTGCVTQLSFVLLFAGMEDFLLAAMAYDRYVAICKPLHYTAIMKTHLCLVMILLSLCISIVDALLHGLMILRLSFCTFLEIPHYFCELDQVIKLACSDTLINNILVYTMTIALGGVPLVGIIFSYFKIISSILRMPSSGGRHKTFSTCGSHLSVVSLFYGTAFGIYISSAFTESYRQTSVASLMYTVIPPMLNPFIYSLRSKDMKKALRKII", "length": 305, "header": "tr|A0A0G2JYC1-1|A0A0G2JYC1_RAT Isoform 1 of Olfactory receptor 1151 OS=Rattus norvegicus OX=10116 GN=Or7g33 PE=4 SV=1 CANONICAL=A0A0G2JYC1-1" }, "locus": { "chromosome": "8", "start_pos": 17398159, "end_pos": 17397245, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000079046.2", "url": "https://www.ensembl.org/id/ENSRNOT00000079046.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000070597.1", "url": "https://www.ensembl.org/id/ENSRNOP00000070597.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:300411", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:300411", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8NG99-1", "protein_name": "Olfactory receptor 7G2", "gene_name": "OR7G2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEARNQTAISKFLLLGLIEDPELQPVLFSLFLSMYLVTILGNLLILLAVISDSHLHTPMYFFLSNLSFLDICLSTTTIPKMLVNIQAQNRSITYSGCLTQICFVLFFAGLENCLLAAMAYDRYVAICHPLRYTVIMNPRLCGLLILLSLLTSVVNALLLSLMVLRLSFCTDLEIPLFFCELAQVIQLTCSDTLINNILIYFAACIFGGVPLSGIILSYTQITSCVLRMPSASGKHKAVSTCGSHLSIVLLFYGAGLGVYISSVVTDSPRKTAVASVMYSVFPQMVNPFIYSLRNKDMKGTLRKFIGRIPSLLWCAICFGFRFLE", "length": 324 }, "evidence": [ { "id": "45224467", "url": "http://www.informatics.jax.org/homology/45224467", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8VGG6-1", "protein_name": "Olfactory receptor", "gene_name": "Or7g33", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MELENQTRVIEFFLLGLSEDPELQPILFGLFLLMYLVTVSGNLLIILAIVSDAHLHTPMYFFLSNLSFTDICFSTTTVPKMLTNLQKQSKSISYTGCITQLSFVLLFAGMENFLLAAMAYDRYVAICNPLRYTDIMKLHLCFVMIFLSLYISIVDALLHGLMTLRLSFCTFLEIPHFFCELYQVIKIACSDTLINNILIYVMSSALGGMPLVGIIFSYYKIISSILRMPSPGGRHKAFSTCGSHLSVVSLFYGTAFGVYISSAFTESYRRTSVASLMYTVFPPMLNPFIYSLRNKDMKKALRKIV", "length": 305 }, "evidence": [ { "id": "45224467", "url": "http://www.informatics.jax.org/homology/45224467", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYC1", "url": "https://www.uniprot.org/uniprot/A0A0G2JYC1" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYC1", "url": "https://www.uniprot.org/uniprot/A0A0G2JYC1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYC1", "url": "https://www.uniprot.org/uniprot/A0A0G2JYC1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JYC1", "url": "https://www.uniprot.org/uniprot/A0A0G2JYC1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" }, { "start_pos": 65, "end_pos": 67, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }