{ "uniprot_canonical_ac": "A0A0G2JY37-1", "uniprot_ac": "A0A0G2JY37", "uniprot_id": "A0A0G2JY37_RAT", "mass": { "chemical_mass": 36108.0, "monoisotopic_mass": 36108.0 }, "refseq": { "ac": "NP_001000267", "name": "olfactory receptor Olr1668", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000267" }, "gene_names": [ { "name": "Or2n1e", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2JY37", "id": "A0A0G2JY37" }, { "name": "Olr1668", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000267", "id": "NP_001000267" }, { "name": "Or2n1e", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000267", "id": "NP_001000267" } ], "protein_names": [ { "name": "Olfactory receptor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "A0A0G2JY37" }, { "name": "olfactory receptor 1668; olfactory receptor gene Olr1668", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000267", "id": "NP_001000267" }, { "name": "olfactory receptor Olr1668", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000267", "id": "NP_001000267" } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001000267", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000267" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JY37", "url": "https://www.uniprot.org/uniprot/A0A0G2JY37" } ], "common_name": "Rat" } ], "gene": [ { "name": "Or2n1e", "url": "https://www.uniprot.org/uniprot/A0A0G2JY37", "locus": {} } ], "crossref": [ { "id": "ENSRNOG00000053746", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000053746", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15947", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15947", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "294140", "url": "https://www.ncbi.nlm.nih.gov/gene/294140", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:294140", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:294140", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "MAVMNES", "url": "https://omabrowser.org/oma/group/MAVMNES/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4790557at2759", "url": "http://www.orthodb.org/?query=4790557at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR26453", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR26453:SF222", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453:SF222", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "1332634", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1332634", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2JY37", "url": "https://www.uniprot.org/uniprot/A0A0G2JY37", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JY37-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JY37-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZQA4", "url": "https://www.uniprot.org/uniprot/A0A8I5ZQA4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZQA4-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZQA4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGKIYQRRMAVSNESHPKEFILLGFADHPWLELPLFVTLLITYPMALMGNIAIILVSTLDPRLHSPMYFFLRNLSFLDMCYTTSVVPQMLFNLGSSRKTISYVGCVIQLYIFHVMGGTECLLLAIMSIDRYVAICRPLHYTLIMSQRVCVLSVSIMWLTGVIFGFSEATLTLQLPLCGQYKLDHLLCEIPVLIKTACGEKEFNELALSVVCIFILIVPLFLILASYVNIGRAVLRIKSSEGRRKAFGTCSSHLIVVSLFYGPGMSMYLQPPSSITRDQPKFMALFYAVITPTLNPFIYTLRNKDVKGALKKLLRSIFSSK", "length": 320, "header": "tr|A0A0G2JY37-1|A0A0G2JY37_RAT Isoform 1 of Olfactory receptor OS=Rattus norvegicus OX=10116 GN=Or2n1e PE=3 SV=2 CANONICAL=A0A0G2JY37-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JY37-1", "url": "", "sequence": { "sequence": "MGKIYQRRMAVSNESHPKEFILLGFADHPWLELPLFVTLLITYPMALMGNIAIILVSTLDPRLHSPMYFFLRNLSFLDMCYTTSVVPQMLFNLGSSRKTISYVGCVIQLYIFHVMGGTECLLLAIMSIDRYVAICRPLHYTLIMSQRVCVLSVSIMWLTGVIFGFSEATLTLQLPLCGQYKLDHLLCEIPVLIKTACGEKEFNELALSVVCIFILIVPLFLILASYVNIGRAVLRIKSSEGRRKAFGTCSSHLIVVSLFYGPGMSMYLQPPSSITRDQPKFMALFYAVITPTLNPFIYTLRNKDVKGALKKLLRSIFSSK", "length": 320, "header": "tr|A0A0G2JY37-1|A0A0G2JY37_RAT Isoform 1 of Olfactory receptor OS=Rattus norvegicus OX=10116 GN=Or2n1e PE=3 SV=2 CANONICAL=A0A0G2JY37-1" }, "locus": { "chromosome": "20", "start_pos": 186551, "end_pos": 175990, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000089844.2", "url": "https://www.ensembl.org/id/ENSRNOT00000089844.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000070506.2", "url": "https://www.ensembl.org/id/ENSRNOP00000070506.2" } ] } }, { "isoform_ac": "A0A8I5ZQA4-1", "url": "", "sequence": { "sequence": "MAVSNESHPKEFILLGFADHPWLELPLFVTLLITYPMALMGNIAIILVSTLDPRLHSPMYFFLRNLSFLDMCYTTSVVPQMLFNLGSSRKTISYVGCVIQLYIFHVMGGTECLLLAIMSIDRYVAICRPLHYTLIMSQRVCVLSVSIMWLTGVIFGFSEATLTLQLPLCGQYKLDHLLCEIPVLIKTACGEKEFNELALSVVCIFILIVPLFLILASYVNIGRAVLRIKSSEGRRKAFGTCSSHLIVVSLFYGPGMSMYLQPPSSITRDQPKFMALFYAVITPTLNPFIYTLRNKDVKGALKKLLRSIFSSK", "length": 312, "header": "tr|A0A8I5ZQA4-1|A0A8I5ZQA4_RAT Computationally mapped isoform of Olfactory receptor OS=Rattus norvegicus OX=10116 GN=Or2n1e PE=3 SV=1 CANONICAL=A0A0G2JY37-1" }, "locus": { "chromosome": "20", "start_pos": 176925, "end_pos": 175990, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000105465.1", "url": "https://www.ensembl.org/id/ENSRNOT00000105465.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000097154.1", "url": "https://www.ensembl.org/id/ENSRNOP00000097154.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:294140", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:294140", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q7TRI7-1", "protein_name": "Olfactory receptor", "gene_name": "Or2n1e", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAVTNESHPKEFILLGFANHPWLELPLFVTLLITYPMALMGNIAIILVSTLDPRLYSPMYFFLKNLSFLDMCYTTSIVPQMLFNLGSSRKTITYIGCVVQLYVFHIMGGTECLLLAIMSFDRYVAICKPLHYTLIMNQRVCILSVSIMWLTGVIFGFSEATLTLQLPLCGTNKLDHLLCEIPVLIKTACGEKEFNELALSVVCIFILIVPLCLILASYVNIGCAVLRIKSSEGRRKAFGTCSSHLIVVSLFYGPGISMYLQPSSSITRDQPKFMALFYAVITPTLNPFIYTLRNKDVKGAFKKLLRSIFSSK", "length": 312 }, "evidence": [ { "id": "45245314", "url": "http://www.informatics.jax.org/homology/45245314", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8VG72-1", "protein_name": "Olfactory receptor", "gene_name": "Or2n1d", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAVTNESHPKEFILLGFANHPWLELPLFVTLLITYPMALMGNIAIILVSTLDPRLHSPMYFFLTNLSFLDMCYTTSIVPQMLFNLGSSRKTITYIGCVVQLYVFHIMGGTECLLLAIMSFDRYVAICKPLHYTLIMNQRVCILLVSIMWLTGVIFAFSEATLTLQLPLCGIHKLDHLLCEIPVLIKTACGEKESNELALSVVCIFILAVPLCLILASYVNIGCAVLRIKSSEGRKKAFGTCSSHLVVVSLFYGPAISMYLQPSSSITRDQPKFMALFYAVITPTLNPFIYTLRNKDVKGALKKLLRSIFSSK", "length": 312 }, "evidence": [ { "id": "45245313", "url": "http://www.informatics.jax.org/homology/45245313", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JY37", "url": "https://www.uniprot.org/uniprot/A0A0G2JY37" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JY37", "url": "https://www.uniprot.org/uniprot/A0A0G2JY37" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JY37", "url": "https://www.uniprot.org/uniprot/A0A0G2JY37" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "detection of chemical stimulus involved in sensory perception of smell", "id": "GO:0050911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050911", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JY37", "url": "https://www.uniprot.org/uniprot/A0A0G2JY37" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 13, "end_pos": 15, "annotation": "n_glycosylation_sequon" }, { "start_pos": 73, "end_pos": 75, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }