{ "uniprot_canonical_ac": "A0A0G2JWM6-1", "uniprot_ac": "A0A0G2JWM6", "uniprot_id": "A0A0G2JWM6_RAT", "mass": { "chemical_mass": 17553.0, "monoisotopic_mass": 17553.0 }, "refseq": {}, "gene_names": [ { "name": "Tcf24", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2JWM6", "id": "A0A0G2JWM6" } ], "protein_names": [ { "name": "Transcription factor 24", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "A0A0G2JWM6" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JWM6", "url": "https://www.uniprot.org/uniprot/A0A0G2JWM6" } ], "common_name": "Rat" } ], "gene": [ { "name": "Tcf24", "url": "https://www.uniprot.org/uniprot/A0A0G2JWM6", "locus": { "chromosome": "5", "start_pos": 9279636, "end_pos": 9227131, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000052668", "url": "https://www.ensembl.org/id/ENSRNOG00000052668" } ] } } ], "crossref": [ { "id": "ENSRNOG00000052668", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000052668", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd19710", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19710", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR011598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036638", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036638", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:680678", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:680678", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SHNDAPA", "url": "https://omabrowser.org/oma/group/SHNDAPA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3108384at2759", "url": "http://www.orthodb.org/?query=3108384at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23349", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23349", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23349:SF48", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23349:SF48", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00010", "url": "http://pfam.xfam.org/family/PF00010", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "1589398", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1589398", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0G2JWM6", "url": "https://www.uniprot.org/uniprot/A0A0G2JWM6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JWM6-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JWM6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MERGRPSSSPRSAEPAPPAAAAAAAARDSSPGQTGAGPTGPGGVAARSGSGRPAAANAARERSRVQTLRHAFLELQRTLPSVPPDTKLSKLDVLLLATTYIAHLTRSLQDDTDAPGDPSLGALRGDGYLHPVKKWPMRSRLYIGATGQFLKHSVPGEKGSHNDAPAASPP", "length": 170, "header": "tr|A0A0G2JWM6-1|A0A0G2JWM6_RAT Isoform 1 of Transcription factor 24 OS=Rattus norvegicus OX=10116 GN=Tcf24 PE=4 SV=2 CANONICAL=A0A0G2JWM6-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JWM6-1", "url": "", "sequence": { "sequence": "MERGRPSSSPRSAEPAPPAAAAAAAARDSSPGQTGAGPTGPGGVAARSGSGRPAAANAARERSRVQTLRHAFLELQRTLPSVPPDTKLSKLDVLLLATTYIAHLTRSLQDDTDAPGDPSLGALRGDGYLHPVKKWPMRSRLYIGATGQFLKHSVPGEKGSHNDAPAASPP", "length": 170, "header": "tr|A0A0G2JWM6-1|A0A0G2JWM6_RAT Isoform 1 of Transcription factor 24 OS=Rattus norvegicus OX=10116 GN=Tcf24 PE=4 SV=2 CANONICAL=A0A0G2JWM6-1" }, "locus": { "chromosome": "5", "start_pos": 9279472, "end_pos": 9275547, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000088164.2", "url": "https://www.ensembl.org/id/ENSRNOT00000088164.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000069940.2", "url": "https://www.ensembl.org/id/ENSRNOP00000069940.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:680678", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:680678", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JWM6", "url": "https://www.uniprot.org/uniprot/A0A0G2JWM6" } ], "pmid": "" }, { "name": "developmental process", "id": "GO:0032502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032502", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JWM6", "url": "https://www.uniprot.org/uniprot/A0A0G2JWM6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "protein dimerization activity", "id": "GO:0046983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046983", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JWM6", "url": "https://www.uniprot.org/uniprot/A0A0G2JWM6" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulatory region sequence-specific DNA binding", "id": "GO:0000977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000977", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JWM6", "url": "https://www.uniprot.org/uniprot/A0A0G2JWM6" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JWM6", "url": "https://www.uniprot.org/uniprot/A0A0G2JWM6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }